Gene/Proteome Database (LMPD)
LMPD ID
LMP006888
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
bifunctional (2E,6E)-farnesyl diphosphate synthase/dimethylallyltranstransferase
Gene Symbol
Synonyms
BOT3; FDS1; FPP1
Alternate Names
bifunctional (2E,6E)-farnesyl diphosphate synthase/dimethylallyltranstransferase
Chromosome
X
EC Number
2.5.1.10
Proteins
bifunctional (2E,6E)-farnesyl diphosphate synthase/dimethylallyltranstransferase | |
---|---|
Refseq ID | NP_012368 |
Protein GI | 6322294 |
UniProt ID | P08524 |
mRNA ID | NM_001181600 |
Length | 352 |
RefSeq Status | PROVISIONAL |
MASEKEIRRERFLNVFPKLVEELNASLLAYGMPKEACDWYAHSLNYNTPGGKLNRGLSVVDTYAILSNKTVEQLGQEEYEKVAILGWCIELLQAYFLVADDMMDKSITRRGQPCWYKVPEVGEIAINDAFMLEAAIYKLLKSHFRNEKYYIDITELFHEVTFQTELGQLMDLITAPEDKVDLSKFSLKKHSFIVTFKTAYYSFYLPVALAMYVAGITDEKDLKQARDVLIPLGEYFQIQDDYLDCFGTPEQIGKIGTDIQDNKCSWVINKALELASAEQRKTLDENYGKKDSVAEAKCKKIFNDLKIEQLYHEYEESIAKDLKAKISQVDESRGFKADVLTAFLNKVYKRSK |
Gene Information
Entrez Gene ID
Gene Name
bifunctional (2E,6E)-farnesyl diphosphate synthase/dimethylallyltranstransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:SGD | C | cytoplasm |
GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
GO:0004161 | IDA:SGD | F | dimethylallyltranstransferase activity |
GO:0004337 | IDA:SGD | F | geranyltranstransferase activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0006696 | IMP:SGD | P | ergosterol biosynthetic process |
GO:0045337 | IDA:SGD | P | farnesyl diphosphate biosynthetic process |
GO:0033384 | IEA:UniProtKB-UniPathway | P | geranyl diphosphate biosynthetic process |
GO:0008299 | IDA:SGD | P | isoprenoid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
bifunctional (2E,6E)-farnesyl diphosphate synthase/dimethylallyltranstransferase
Protein Entry
FPPS_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Dimethylallyl diphosphate + isopentenyl diphosphate = diphosphate + geranyl diphosphate. |
Catalytic Activity | Geranyl diphosphate + isopentenyl diphosphate = diphosphate + (2E,6E)-farnesyl diphosphate. |
Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 3 Mg(2+) ions per subunit. {ECO:0000250}; |
Function | Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate. |
Pathway | Isoprenoid biosynthesis; farnesyl diphosphate biosynthesis; farnesyl diphosphate from geranyl diphosphate and isopentenyl diphosphate: step 1/1. |
Pathway | Isoprenoid biosynthesis; geranyl diphosphate biosynthesis; geranyl diphosphate from dimethylallyl diphosphate and isopentenyl diphosphate: step 1/1. |
Similarity | Belongs to the FPP/GGPP synthase family. {ECO:0000305}. |
Subcellular Location | Cytoplasm. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006888 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6322294 | RefSeq | NP_012368 | 352 | bifunctional (2E,6E)-farnesyl diphosphate synthase/dimethylallyltranstransferase |
Identical Sequences to LMP006888 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6322294 | GenBank | AFX58146.1 | 352 | Sequence 104 from patent US 8309323 |
GI:6322294 | GenBank | AFX58161.1 | 352 | Sequence 157 from patent US 8309323 |
GI:6322294 | GenBank | EWG84973.1 | 352 | Erg20p [Saccharomyces cerevisiae R008] |
GI:6322294 | GenBank | EWG90260.1 | 352 | Erg20p [Saccharomyces cerevisiae P301] |
GI:6322294 | GenBank | EWH17730.1 | 352 | Erg20p [Saccharomyces cerevisiae P283] |
GI:6322294 | gnl | McCuskerlabDuke | 352 | Erg20p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP006888 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6322294 | DBBJ | GAA24199.1 | 352 | K7_Erg20p [Saccharomyces cerevisiae Kyokai no. 7] |
GI:6322294 | GenBank | EDN63217.1 | 352 | FPP synthetase [Saccharomyces cerevisiae YJM789] |
GI:6322294 | GenBank | EGA58189.1 | 352 | Erg20p [Saccharomyces cerevisiae FostersB] |
GI:6322294 | GenBank | EIW09696.1 | 352 | Erg20p [Saccharomyces cerevisiae CEN.PK113-7D] |
GI:6322294 | GenBank | AFX58147.1 | 352 | Sequence 106 from patent US 8309323 |
GI:6322294 | GenBank | AFX58148.1 | 352 | Sequence 108 from patent US 8309323 |