Gene/Proteome Database (LMPD)
Proteins
hexaprenyldihydroxybenzoate methyltransferase | |
---|---|
Refseq ID | NP_014545 |
Protein GI | 37362692 |
UniProt ID | P27680 |
mRNA ID | NM_001183350 |
Length | 312 |
RefSeq Status | PROVISIONAL |
MLLRSRFLKVIHVRKQLSACSRFAIQTQTRCKSTDASEDEVKHFQELAPTWWDTDGSQRILHKMNLTRLDFVQRTVRNQVKIQNPEIFVPGFNYKEFLPEYVCDNIQREMQESIETNLDKRPEVSVLDVGCGGGILSESLARLKWVKNVQGIDLTRDCIMVAKEHAKKDPMLEGKINYECKALEDVTGQFDIITCMEMLEHVDMPSEILRHCWSRLNPEKGILFLSTINRDLISWFTTIFMGENVLKIVPKGTHHLSKYINSKEILAWFNDNYSGQFRLLDLKGTMYLPYQGWVEHDCSDVGNYFMAIQRLN |
Gene Information
Entrez Gene ID
Gene Name
hexaprenyldihydroxybenzoate methyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0019898 | IDA:SGD | C | extrinsic component of membrane |
GO:0005743 | IDA:SGD | C | mitochondrial inner membrane |
GO:0005739 | IDA:SGD | C | mitochondrion |
GO:0008425 | IEA:InterPro | F | 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity |
GO:0061543 | IMP:SGD | F | 3-demethylubiquinone-6 3-O-methyltransferase activity |
GO:0008689 | IEA:UniProtKB-EC | F | 3-demethylubiquinone-9 3-O-methyltransferase activity |
GO:0004395 | IMP:SGD | F | hexaprenyldihydroxybenzoate methyltransferase activity |
GO:0006744 | IDA:SGD | P | ubiquinone biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
sce00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
sce_M00128 | Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-7230 | ubiquinol-6 biosynthesis from 4-aminobenzoate |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hexaprenyldihydroxybenzoate methyltransferase
Protein Entry
COQ3_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Catalytic Activity | S-adenosyl-L-methionine + 2-hexaprenyl-3- methyl-5-hydroxy-6-methoxy-1,4-benzoquinol = S-adenosyl-L- homocysteine + ubiquinol. {ECO:0000269|PubMed:10419476}. |
Catalytic Activity | S-adenosyl-L-methionine + 3,4-dihydroxy-5-all- trans-polyprenylbenzoate = S-adenosyl-L-homocysteine + 3-methoxy- 4-hydroxy-5-all-trans-polyprenylbenzoate. {ECO:0000269|PubMed:10419476}. |
Catalytic Activity | S-adenosyl-L-methionine + 3- demethylubiquinone-n = S-adenosyl-L-homocysteine + ubiquinone-n. {ECO:0000269|PubMed:10419476}. |
Catalytic Activity | S-adenosyl-L-methionine + 3-(all-trans- polyprenyl)benzene-1,2-diol = S-adenosyl-L-homocysteine + 2- methoxy-6-(all-trans-polyprenyl)phenol. {ECO:0000269|PubMed:10419476}. |
Enzyme Regulation | Regulated in response to catabolite repression. |
Function | Non-specific O-methyltransferase that catalyzes the 2 O- methylation steps in the ubiquinone biosynthetic pathway. {ECO:0000269|PubMed:10419476}. |
Miscellaneous | Present with 259 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
Sequence Caution | Sequence=AAB63972.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAA88165.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAA99108.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAA99109.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
Similarity | Belongs to the methyltransferase superfamily. UbiG/COQ3 family. {ECO:0000305}. |
Subcellular Location | Mitochondrion inner membrane {ECO:0000269|PubMed:10419476, ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:14576278}; Peripheral membrane protein {ECO:0000269|PubMed:10419476, ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:14576278}; Matrix side {ECO:0000269|PubMed:10419476, ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:14576278}. |
Subunit | Interacts with COQ4. {ECO:0000269|PubMed:15792955}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006903 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
37362692 | RefSeq | NP_014545 | 312 | hexaprenyldihydroxybenzoate methyltransferase |
Identical Sequences to LMP006903 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:37362692 | GenBank | EIW07834.1 | 312 | Coq3p [Saccharomyces cerevisiae CEN.PK113-7D] |
GI:37362692 | SwissProt | P27680.2 | 312 | RecName: Full=Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial; AltName: Full=2-polyprenyl-6-hydroxyphenol methylase; AltName: Full=3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase; Short=DHHB methyltransferase; Short=DHHB-MT; Short=DHHB-MTase; AltName: Full=3-demethylubiquinone-6 3-methyltransferase; AltName: Full=Dihydroxyhexaprenylbenzoate methyltransferase; Flags: Precursor [Saccharomyces cerevisiae S288c] |
GI:37362692 | Third Party Genbank | DAA10688.1 | 312 | TPA: hexaprenyldihydroxybenzoate methyltransferase [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP006903 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:37362692 | DBBJ | GAA26232.1 | 312 | K7_Coq3p [Saccharomyces cerevisiae Kyokai no. 7] |
GI:37362692 | EMBL | CAA88165.1 | 316 | dihydroxyhexaprenylbenzoate methyltransferase [Saccharomyces cerevisiae] |
GI:37362692 | EMBL | CAA99109.1 | 316 | COQ3 [Saccharomyces cerevisiae] |
GI:37362692 | GenBank | AAB63972.1 | 316 | 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase [Saccharomyces cerevisiae] |
GI:37362692 | GenBank | EDN63779.1 | 312 | 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase [Saccharomyces cerevisiae YJM789] |
GI:37362692 | GenBank | EGA73065.1 | 312 | Coq3p [Saccharomyces cerevisiae AWRI796] |