Gene/Proteome Database (LMPD)
Proteins
| succinate dehydrogenase iron-sulfur protein subunit SDH2 | |
|---|---|
| Refseq ID | NP_013059 |
| Protein GI | 6322987 |
| UniProt ID | P21801 |
| mRNA ID | NM_001181861 |
| Length | 266 |
| RefSeq Status | PROVISIONAL |
| MLNVLLRRKAFCLVTKKGMATATTAAATHTPRLKTFKVYRWNPDEPSAKPHLQSYQVDLNDCGPMVLDALLKIKDEQDSTLTFRRSCREGICGSCAMNIGGRNTLACICKIDQNESKQLKIYPLPHMFIVKDLVPDLTNFYQQYKSIQPYLQRSSFPKDGTEVLQSIEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDQATKTRKAMLNNSMSLYRCHTIMNCTRTCPKGLNPGLAIAEIKKSLAFA | |
Gene Information
Entrez Gene ID
Gene Name
succinate dehydrogenase iron-sulfur protein subunit SDH2
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031966 | IDA:SGD | C | mitochondrial membrane |
| GO:0005749 | IDA:SGD | C | mitochondrial respiratory chain complex II |
| GO:0051537 | IEA:UniProtKB-KW | F | 2 iron, 2 sulfur cluster binding |
| GO:0051538 | IEA:UniProtKB-KW | F | 3 iron, 4 sulfur cluster binding |
| GO:0051539 | IEA:UniProtKB-KW | F | 4 iron, 4 sulfur cluster binding |
| GO:0009055 | IEA:InterPro | F | electron carrier activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0008177 | IDA:SGD | F | succinate dehydrogenase (ubiquinone) activity |
| GO:0045333 | IMP:SGD | P | cellular respiration |
| GO:0006121 | TAS:SGD | P | mitochondrial electron transport, succinate to ubiquinone |
| GO:0006099 | IMP:SGD | P | tricarboxylic acid cycle |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce00020 | Citrate cycle (TCA cycle) |
| sce_M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| TCA-EUK-PWY-YEAST | TCA cycle, aerobic respiration |
| PWY-7279-YEAST | aerobic respiration (cytochrome c) |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site |
| IPR001041 | 2Fe-2S ferredoxin-type domain |
| IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site |
| IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| IPR009051 | Alpha-helical ferredoxin |
| IPR012675 | Beta-grasp domain |
| IPR025192 | Succinate dehydogenase/fumarate reductase N-terminal |
| IPR004489 | Succinate dehydrogenase/fumarate reductase iron-sulphur protein |
UniProt Annotations
Entry Information
Gene Name
succinate dehydrogenase iron-sulfur protein subunit SDH2
Protein Entry
SDHB_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Succinate + a quinone = fumarate + a quinol. |
| Cofactor | Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence={ECO:0000250}; Note=Binds 1 [2Fe-2S] cluster. {ECO:0000250}; |
| Cofactor | Name=[3Fe-4S] cluster; Xref=ChEBI:CHEBI:21137; Evidence={ECO:0000250}; Note=Binds 1 [3Fe-4S] cluster. {ECO:0000250}; |
| Cofactor | Name=[4Fe-4S] cluster; Xref=ChEBI:CHEBI:49883; Evidence={ECO:0000250}; Note=Binds 1 [4Fe-4S] cluster. {ECO:0000250}; |
| Function | Subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). SDH1 and SDH2 form the catalytic dimer. Electrons flow from succinate to the FAD bound to SDH1, and sequentially through the iron-sulfur clusters bound to SDH2 and enter the membrane dimer formed by SDH3 and SDH4. |
| Miscellaneous | Present with 9540 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Carbohydrate metabolism; tricarboxylic acid cycle; fumarate from succinate (eukaryal route): step 1/1. |
| Similarity | Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. {ECO:0000305}. |
| Similarity | Contains 1 2Fe-2S ferredoxin-type domain. {ECO:0000255|PROSITE-ProRule:PRU00465}. |
| Similarity | Contains 1 4Fe-4S ferredoxin-type domain. {ECO:0000255|PROSITE-ProRule:PRU00711}. |
| Subcellular Location | Mitochondrion inner membrane; Peripheral membrane protein; Matrix side. |
| Subunit | Component of complex II composed of four subunits: a flavoprotein (FP), an iron-sulfur protein (IP), and a cytochrome b composed of a large and a small subunit. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006932 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6322987 | RefSeq | NP_013059 | 266 | succinate dehydrogenase iron-sulfur protein subunit SDH2 |
Identical Sequences to LMP006932 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6322987 | DBBJ | GAA24849.1 | 266 | K7_Sdh2p [Saccharomyces cerevisiae Kyokai no. 7] |
| GI:6322987 | GenBank | EGA61424.1 | 266 | Sdh2p [Saccharomyces cerevisiae FostersO] |
| GI:6322987 | GenBank | EIW08758.1 | 266 | Sdh2p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6322987 | GenBank | AFQ83464.1 | 266 | Sequence 138 from patent US 8247651 |
| GI:6322987 | GenBank | EWG94588.1 | 266 | Sdh2p [Saccharomyces cerevisiae R103] |
| GI:6322987 | GenBank | EWH17143.1 | 266 | Sdh2p [Saccharomyces cerevisiae P283] |
Related Sequences to LMP006932 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6322987 | GenBank | EGA73998.1 | 266 | Sdh2p [Saccharomyces cerevisiae AWRI796] |
| GI:6322987 | GenBank | EGA77794.1 | 266 | Sdh2p [Saccharomyces cerevisiae Vin13] |
| GI:6322987 | GenBank | EGA85718.1 | 266 | Sdh2p [Saccharomyces cerevisiae VL3] |
| GI:6322987 | GenBank | EWG84246.1 | 266 | Sdh2p [Saccharomyces cerevisiae R008] |
| GI:6322987 | GenBank | EWG89938.1 | 266 | Sdh2p [Saccharomyces cerevisiae P301] |
| GI:6322987 | gnl | McCuskerlabDuke | 266 | Sdh2p [Saccharomyces cerevisiae YJM993] |