Gene/Proteome Database (LMPD)
Proteins
glutathione peroxidase GPX1 | |
---|---|
Refseq ID | NP_012899 |
Protein GI | 398364659 |
UniProt ID | P36014 |
mRNA ID | NM_001179592 |
Length | 167 |
MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI |
Gene Information
Entrez Gene ID
Gene Name
glutathione peroxidase GPX1
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0031315 | IDA:SGD | C | extrinsic component of mitochondrial outer membrane |
GO:0005782 | IDA:SGD | C | peroxisomal matrix |
GO:0004602 | IMP:SGD | F | glutathione peroxidase activity |
GO:0047066 | IDA:SGD | F | phospholipid-hydroperoxide glutathione peroxidase activity |
GO:0034599 | IMP:SGD | P | cellular response to oxidative stress |
GO:0007031 | IMP:SGD | P | peroxisome organization |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00590 | Arachidonic acid metabolism |
sce00590 | Arachidonic acid metabolism |
ko00480 | Glutathione metabolism |
sce00480 | Glutathione metabolism |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-4081 | glutathione redox reactions I |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5618448 | Arachidonic acid metabolism |
5618061 | Cellular responses to stress |
5618060 | Detoxification of Reactive Oxygen Species |
5618023 | Metabolism |
5618091 | Metabolism of lipids and lipoproteins |
5618059 | Metabolism of nucleotides |
5618057 | Purine catabolism |
5618058 | Purine metabolism |
5618641 | Synthesis of 12-eicosatetraenoic acid derivatives |
5618639 | Synthesis of 15-eicosatetraenoic acid derivatives |
5618640 | Synthesis of 5-eicosatetraenoic acids |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glutathione peroxidase GPX1
Protein Entry
GPX1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O. |
Function | May constitute a glutathione peroxidase-like protective system against oxidative stresses |
Function | May constitute a glutathione peroxidase-like protective system against oxidative stresses. {ECO:0000250}. |
Interaction | P36156:ECM4; NbExp=1; IntAct=EBI-7857, EBI-2042717; P38799:YHR078W; NbExp=1; IntAct=EBI-7857, EBI-24593; |
Similarity | Belongs to the glutathione peroxidase family |
Similarity | Belongs to the glutathione peroxidase family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006933 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
398364659 | RefSeq | NP_012899 | 167 | glutathione peroxidase GPX1 |
Identical Sequences to LMP006933 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP006933 proteins
Reference | Database | Accession | Length | Protein Name |
---|