Gene/Proteome Database (LMPD)

LMPD ID
LMP006933
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
glutathione peroxidase GPX1
Gene Symbol
Synonyms
-
Chromosome
XI
EC Number
1.11.1.9;

Proteins

glutathione peroxidase GPX1
Refseq ID NP_012899
Protein GI 398364659
UniProt ID P36014
mRNA ID NM_001179592
Length 167
MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI

Gene Information

Entrez Gene ID
Gene Name
glutathione peroxidase GPX1
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031315 IDA:SGD C extrinsic component of mitochondrial outer membrane
GO:0005782 IDA:SGD C peroxisomal matrix
GO:0004602 IMP:SGD F glutathione peroxidase activity
GO:0047066 IDA:SGD F phospholipid-hydroperoxide glutathione peroxidase activity
GO:0034599 IMP:SGD P cellular response to oxidative stress
GO:0007031 IMP:SGD P peroxisome organization

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
sce00590 Arachidonic acid metabolism
ko00480 Glutathione metabolism
sce00480 Glutathione metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-4081 glutathione redox reactions I

REACTOME Pathway Links

REACTOME Pathway ID Description
5618448 Arachidonic acid metabolism
5618061 Cellular responses to stress
5618060 Detoxification of Reactive Oxygen Species
5618023 Metabolism
5618091 Metabolism of lipids and lipoproteins
5618059 Metabolism of nucleotides
5618057 Purine catabolism
5618058 Purine metabolism
5618641 Synthesis of 12-eicosatetraenoic acid derivatives
5618639 Synthesis of 15-eicosatetraenoic acid derivatives
5618640 Synthesis of 5-eicosatetraenoic acids

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase GPX1
Protein Entry
GPX1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function May constitute a glutathione peroxidase-like protective system against oxidative stresses
Function May constitute a glutathione peroxidase-like protective system against oxidative stresses. {ECO:0000250}.
Interaction P36156:ECM4; NbExp=1; IntAct=EBI-7857, EBI-2042717; P38799:YHR078W; NbExp=1; IntAct=EBI-7857, EBI-24593;
Similarity Belongs to the glutathione peroxidase family
Similarity Belongs to the glutathione peroxidase family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP006933 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398364659 RefSeq NP_012899 167 glutathione peroxidase GPX1

Identical Sequences to LMP006933 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP006933 proteins

Reference Database Accession Length Protein Name