Gene/Proteome Database (LMPD)
Proteins
| xanthine phosphoribosyltransferase | |
|---|---|
| Refseq ID | NP_012667 |
| Protein GI | 6322593 |
| UniProt ID | P47165 |
| mRNA ID | NM_001181791 |
| Length | 209 |
| MAENERMYISYNNIHKLCQGVAKHILARNERPDIIIAITGGGMIPARIIRSFLKTKGQKNIPIQAIGLSLYEDLGLDNSVETIGKEVIRTQWLDFGALNQHFDSLIGKKVLIVDEVDDTRTTLHYAVSELEKEIAEQQKVLNRMSEETVISIFVLHNKDKPKRAGLPDSMMNSGRYIAAQTVPDKWLCYPWDAEDIEEHTMLAKAQGHD | |
Gene Information
Entrez Gene ID
Gene Name
xanthine phosphoribosyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0004422 | IGI:SGD | F | hypoxanthine phosphoribosyltransferase activity |
| GO:0000310 | IMP:SGD | F | xanthine phosphoribosyltransferase activity |
| GO:0032265 | IMP:SGD | P | XMP salvage |
| GO:0046100 | IGI:SGD | P | hypoxanthine metabolic process |
| GO:0009116 | IEA:InterPro | P | nucleoside metabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-6610 | adenine and adenosine salvage IV |
| PWY-6620 | guanine and guanosine salvage I |
| PWY3O-2220 | salvage pathways of adenine, hypoxanthine and their nucleosides |
| PWY3O-743 | salvage pathways of guanine, xanthine and their nucleosides |
| PWY3O-1 | superpathway of purine nucleosides salvage |
| SALVPURINE2-PWY | xanthine and xanthosine salvage |
Domain Information
UniProt Annotations
Entry Information
Gene Name
xanthine phosphoribosyltransferase
Protein Entry
XPT1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Function | May act as a xanthine phosphoribosyltransferase involved in the synthesis of purine nucleotides. Such activity is however unclear in vivo |
| Function | May act as a xanthine phosphoribosyltransferase involved in the synthesis of purine nucleotides. Such activity is however unclear in vivo. {ECO:0000269|PubMed:10217799}. |
| Miscellaneous | Present with 721 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 721 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Subcellular Location | Cytoplasm . |
| Subcellular Location | Cytoplasm {ECO:0000269|PubMed:14562095}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006946 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6322593 | RefSeq | NP_012667 | 209 | xanthine phosphoribosyltransferase |
Identical Sequences to LMP006946 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP006946 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|