Gene/Proteome Database (LMPD)
Proteins
Acp1p | |
---|---|
Refseq ID | NP_012729 |
Protein GI | 6322656 |
UniProt ID | P32463 |
mRNA ID | NM_001179758 |
Length | 125 |
RefSeq Status | PROVISIONAL |
MFRSVCRISSRVAPSAYRTIMGRSVMSNTILAQRFYSANLSKDQVSQRVIDVIKAFDKNSPNIANKQISSDTQFHKDLGLDSLDTVELLVAIEEEFDIEIPDKVADELRSVGETVDYIASNPDAN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
GO:0070469 | IEA:UniProtKB-KW | C | respiratory chain |
GO:0000036 | ISS:SGD | F | ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process |
GO:0009107 | IMP:SGD | P | lipoate biosynthetic process |
GO:0055114 | IEA:UniProtKB-KW | P | oxidation-reduction process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of very-long-chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity). {ECO:0000250}. |
Miscellaneous | Present with 60500 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Ptm | 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by acpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group (By similarity). {ECO:0000250}. |
Similarity | Contains 1 acyl carrier domain. {ECO:0000305}. |
Subcellular Location | Mitochondrion. |
Subunit | Complex I is composed of about 30 different subunits. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006948 (as displayed in Record Overview)
Identical Sequences to LMP006948 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6322656 | GenBank | EIW09321.1 | 125 | Acp1p [Saccharomyces cerevisiae CEN.PK113-7D] |
GI:6322656 | GenBank | EWG84678.1 | 125 | Acp1p [Saccharomyces cerevisiae R008] |
GI:6322656 | GenBank | EWG89990.1 | 125 | Acp1p [Saccharomyces cerevisiae P301] |
GI:6322656 | GenBank | EWG94832.1 | 125 | Acp1p [Saccharomyces cerevisiae R103] |
GI:6322656 | GenBank | EWH17478.1 | 125 | Acp1p [Saccharomyces cerevisiae P283] |
GI:6322656 | gnl | McCuskerlabDuke | 125 | Acp1p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP006948 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6322656 | DBBJ | GAA24543.1 | 125 | K7_Acp1p [Saccharomyces cerevisiae Kyokai no. 7] |
GI:6322656 | EMBL | CAY80900.1 | 125 | Acp1p [Saccharomyces cerevisiae EC1118] |
GI:6322656 | GenBank | EDV12916.1 | 125 | acyl carrier protein [Saccharomyces cerevisiae RM11-1a] |
GI:6322656 | GenBank | EGA86066.1 | 105 | Acp1p [Saccharomyces cerevisiae VL3] |
GI:6322656 | GenBank | EJS42992.1 | 125 | acp1p [Saccharomyces arboricola H-6] |
GI:6322656 | GenBank | EJT42645.1 | 124 | ACP1-like protein [Saccharomyces kudriavzevii IFO 1802] |