Gene/Proteome Database (LMPD)
Proteins
C-5 sterol desaturase | |
---|---|
Refseq ID | NP_013157 |
Protein GI | 6323085 |
UniProt ID | P32353 |
mRNA ID | NM_001181943 |
Length | 365 |
MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVKECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVFDKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRKLIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSISYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDDNDRIYENDPNTKKNN |
Gene Information
Entrez Gene ID
Gene Name
C-5 sterol desaturase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005788 | IDA:SGD | C | endoplasmic reticulum lumen |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0000248 | IDA:SGD | F | C-5 sterol desaturase activity |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0006696 | IMP:SGD | P | ergosterol biosynthetic process |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
sce01110 | Biosynthesis of secondary metabolites |
M00102 | Ergocalciferol biosynthesis |
sce_M00102 | Ergocalciferol biosynthesis |
sce01100 | Metabolic pathways |
ko00100 | Steroid biosynthesis |
sce00100 | Steroid biosynthesis |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-6075 | ergosterol biosynthesis |
PWY-6075 | ergosterol biosynthesis I |
ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis |
ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis I |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ; |
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
Function | Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. May contribute to the regulation of ergosterol biosynthesis. |
Interaction | P53045:ERG25; NbExp=3; IntAct=EBI-6554, EBI-6506; |
Miscellaneous | Present with 36200 molecules/cell in log phase SD medium |
Miscellaneous | Present with 36200 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Steroid metabolism; ergosterol biosynthesis; ergosterol from zymosterol: step 3/5. |
Similarity | Belongs to the sterol desaturase family |
Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Subunit | Interacts with ERG28 |
Subunit | Interacts with ERG28. {ECO:0000269|PubMed:15995173}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006956 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6323085 | RefSeq | NP_013157 | 365 | C-5 sterol desaturase |
Identical Sequences to LMP006956 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP006956 proteins
Reference | Database | Accession | Length | Protein Name |
---|