Gene/Proteome Database (LMPD)
Proteins
| C-5 sterol desaturase | |
|---|---|
| Refseq ID | NP_013157 |
| Protein GI | 6323085 |
| UniProt ID | P32353 |
| mRNA ID | NM_001181943 |
| Length | 365 |
| MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVKECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVFDKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRKLIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSISYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDDNDRIYENDPNTKKNN | |
Gene Information
Entrez Gene ID
Gene Name
C-5 sterol desaturase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005788 | IDA:SGD | C | endoplasmic reticulum lumen |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0000248 | IDA:SGD | F | C-5 sterol desaturase activity |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0006696 | IMP:SGD | P | ergosterol biosynthetic process |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce01110 | Biosynthesis of secondary metabolites |
| M00102 | Ergocalciferol biosynthesis |
| sce_M00102 | Ergocalciferol biosynthesis |
| sce01100 | Metabolic pathways |
| ko00100 | Steroid biosynthesis |
| sce00100 | Steroid biosynthesis |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-6075 | ergosterol biosynthesis |
| PWY-6075 | ergosterol biosynthesis I |
| ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis |
| ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis I |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ; |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Function | Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. May contribute to the regulation of ergosterol biosynthesis. |
| Interaction | P53045:ERG25; NbExp=3; IntAct=EBI-6554, EBI-6506; |
| Miscellaneous | Present with 36200 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 36200 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Steroid metabolism; ergosterol biosynthesis; ergosterol from zymosterol: step 3/5. |
| Similarity | Belongs to the sterol desaturase family |
| Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Subunit | Interacts with ERG28 |
| Subunit | Interacts with ERG28. {ECO:0000269|PubMed:15995173}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006956 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6323085 | RefSeq | NP_013157 | 365 | C-5 sterol desaturase |
Identical Sequences to LMP006956 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP006956 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|