Gene/Proteome Database (LMPD)

LMPD ID
LMP006956
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
C-5 sterol desaturase
Gene Symbol
Synonyms
PSO6; SYR1
Chromosome
XII
EC Number
1.3.3.-

Proteins

C-5 sterol desaturase
Refseq ID NP_013157
Protein GI 6323085
UniProt ID P32353
mRNA ID NM_001181943
Length 365
MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVKECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVFDKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRKLIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSISYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDDNDRIYENDPNTKKNN

Gene Information

Entrez Gene ID
Gene Name
C-5 sterol desaturase
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005788 IDA:SGD C endoplasmic reticulum lumen
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0000248 IDA:SGD F C-5 sterol desaturase activity
GO:0005506 IEA:InterPro F iron ion binding
GO:0006696 IMP:SGD P ergosterol biosynthetic process
GO:0006633 IEA:InterPro P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce01110 Biosynthesis of secondary metabolites
M00102 Ergocalciferol biosynthesis
sce_M00102 Ergocalciferol biosynthesis
sce01100 Metabolic pathways
ko00100 Steroid biosynthesis
sce00100 Steroid biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6075 ergosterol biosynthesis
PWY-6075 ergosterol biosynthesis I
ERGOSTEROL-SYN-PWY superpathway of ergosterol biosynthesis
ERGOSTEROL-SYN-PWY superpathway of ergosterol biosynthesis I

REACTOME Pathway Links

REACTOME Pathway ID Description
5618606 Activation of gene expression by SREBF (SREBP)
5618346 Cholesterol biosynthesis
5618023 Metabolism
5618091 Metabolism of lipids and lipoproteins
5618607 Regulation of cholesterol biosynthesis by SREBP (SREBF)

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
C-5 sterol desaturase
Protein Entry
ERG3_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ;
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Function Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. May contribute to the regulation of ergosterol biosynthesis.
Interaction P53045:ERG25; NbExp=3; IntAct=EBI-6554, EBI-6506;
Miscellaneous Present with 36200 molecules/cell in log phase SD medium
Miscellaneous Present with 36200 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Steroid metabolism; ergosterol biosynthesis; ergosterol from zymosterol: step 3/5.
Similarity Belongs to the sterol desaturase family
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein .
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Subunit Interacts with ERG28
Subunit Interacts with ERG28. {ECO:0000269|PubMed:15995173}.

Identical and Related Proteins

Unique RefSeq proteins for LMP006956 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6323085 RefSeq NP_013157 365 C-5 sterol desaturase

Identical Sequences to LMP006956 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP006956 proteins

Reference Database Accession Length Protein Name