Gene/Proteome Database (LMPD)
Proteins
Ino4p | |
---|---|
Refseq ID | NP_014533 |
Protein GI | 6324464 |
UniProt ID | P13902 |
mRNA ID | NM_001183362 |
Length | 151 |
MTNDIKEIQTIQPGLSEIKEIKGELANVKKRKRRSKKINKLTDGQIRINHVSSEKKRRELERAIFDELVAVVPDLQPQESRSELIIYLKSLSYLSWLYERNEKLRKQIIAKHEAKTGSSSSSDPVQEQNGNIRDLVPKELIWELGDGQSGQ |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005634 | IDA:SGD | C | nucleus |
GO:0003677 | IDA:SGD | F | DNA binding |
GO:0008654 | IMP:SGD | P | phospholipid biosynthetic process |
GO:0045944 | IMP:SGD | P | positive regulation of transcription from RNA polymerase II promoter |
GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Transcriptional activator of phospholipid synthetic genes (such as INO1, CHO1/PSS, CHO2/PEM1, OPI3/PEM2, etc.). |
Interaction | P26798:INO2; NbExp=2; IntAct=EBI-9270, EBI-9262; |
Miscellaneous | Present with 521 molecules/cell in log phase SD medium |
Miscellaneous | Present with 521 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Contains 1 bHLH (basic helix-loop-helix) domain |
Similarity | Contains 1 bHLH (basic helix-loop-helix) domain. {ECO:0000255|PROSITE-ProRule:PRU00981}. |
Subcellular Location | Nucleus . |
Subcellular Location | Nucleus {ECO:0000305}. |
Subunit | Efficient DNA binding requires dimerization with another bHLH protein |
Subunit | Efficient DNA binding requires dimerization with another bHLH protein. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006970 (as displayed in Record Overview)
Identical Sequences to LMP006970 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP006970 proteins
Reference | Database | Accession | Length | Protein Name |
---|