LIPID MAPS

LMPD ID

LMP006975

Gene ID

Species

Saccharomyces cerevisiae S288c (Yeast (S288c))

Gene Name

F0-ATP synthase subunit c (ATPase-associated proteolipid), encoded on the mitochondrial genome; mutation confers oligomycin resistance; expression is specifically dependent on the nuclear genes AEP1 and AEP2

Gene Symbol

OLI1

Synonyms

ATP9; OLI3

Chromosome

MT

F1F0 ATP synthase subunit 9 (mitochondrion)
Refseq ID	NP_009319
Protein GI	6226533
UniProt ID	P61829
mRNA ID	NM_001184366
Length	76
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV

Entrez Gene ID

854584

Gene Name

F0-ATP synthase subunit c (ATPase-associated proteolipid), encoded on the mitochondrial genome; mutation confers oligomycin resistance; expression is specifically dependent on the nuclear genes AEP1 and AEP2

Gene Symbol

OLI1

Species

Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0005829	TAS:Reactome	C	cytosol
GO:0016021	IEA:UniProtKB-KW	C	integral component of membrane
GO:0005743	TAS:Reactome	C	mitochondrial inner membrane
GO:0005758	TAS:Reactome	C	mitochondrial intermembrane space
GO:0000276	IPI:SGD	C	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
GO:0015078	IEA:InterPro	F	hydrogen ion transmembrane transporter activity
GO:0008289	IEA:UniProtKB-KW	F	lipid binding
GO:0006200	IDA:GOC	P	ATP catabolic process
GO:0015991	IEA:InterPro	P	ATP hydrolysis coupled proton transport
GO:0015986	IDA:SGD	P	ATP synthesis coupled proton transport

KEGG Pathway Links

KEGG Pathway ID	Description
M00158	F-type ATPase, eukaryotes
sce_M00158	F-type ATPase, eukaryotes
sce01100	Metabolic pathways
ko00190	Oxidative phosphorylation
sce00190	Oxidative phosphorylation

BIOCYC Pathway Links

BIOCYC Pathway ID	Description
PWY-6126	adenosine nucleotides de novo biosynthesis
PWY-7219	adenosine ribonucleotides de novo biosynthesis
PWY-841	superpathway of purine nucleotides de novo biosynthesis I

REACTOME Pathway Links

REACTOME Pathway ID	Description
5618074	Metabolism of proteins
5618585	Mitochondrial protein import

InterPro Annotations

Accession	Description
IPR000454	ATPase, F0 complex, subunit C
IPR020537	ATPase, F0 complex, subunit C, DCCD-binding site
IPR002379	V-ATPase proteolipid subunit C-like domain

Entry Information

Gene Name

F0-ATP synthase subunit c (ATPase-associated proteolipid), encoded on the mitochondrial genome; mutation confers oligomycin resistance; expression is specifically dependent on the nuclear genes AEP1 and AEP2

Protein Entry

ATP9_YEAST

UniProt ID

P61829

Species

Yeast (S288c)

Comments

Comment Type	Description
Function	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.
Similarity	Belongs to the ATPase C chain family
Similarity	Belongs to the ATPase C chain family. {ECO:0000305}.
Subcellular Location	Mitochondrion membrane {ECO:0000305}; Multi- pass membrane protein {ECO:0000305}.
Subcellular Location	Mitochondrion membrane ; Multi- pass membrane protein .
Subunit	F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. In yeast, the dimeric form of ATP synthase consists of 17 polypeptides: alpha, beta, gamma, delta, epsilon, 4 (B), 5 (OSCP), 6 (A), 8, 9 (C), d, E (Tim11), f, g, h, i/j and k.