Gene/Proteome Database (LMPD)

LMPD ID
LMP006977
Gene ID
853669
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Gene Symbol
TRP3
Synonyms
-
Alternate Names
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Chromosome
XI
EC Number
4.1.3.27

Proteins

bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Refseq ID NP_012711
Protein GI 6322638
UniProt ID P00937
mRNA ID NM_001179776
Length 484
RefSeq Status PROVISIONAL
MSVHAATNPINKHVVLIDNYDSFTWNVYEYLCQEGAKVSVYRNDAITVPEIAALNPDTLLISPGPGHPKTDSGISRDCIRYFTGKIPVFGICMGQQCMFDVFGGEVAYAGEIVHGKTSPISHDNCGIFKNVPQGIAVTRYHSLAGTESSLPSCLKVTASTENGIIMGVRHKKYTVEGVQFHPESILTEEGHLMIRNILNVSGGTWEENKSSPSNSILDRIYARRKIDVNEQSKIPGFTFQDLQSNYDLGLAPPLQDFYTVLSSSHKRAVVLAEVKRASPSKGPICLKAVAAEQALKYAEAGASAISVLTEPHWFHGSLQDLVNVRKILDLKFPPKERPCVLRKEFIFSKYQILEARLAGADTVLLIVKMLSQPLLKELYSYSKDLNMEPLVEVNSKEELQRALEIGAKVVGVNNRDLHSFNVDLNTTSNLVESIPKDVLLIALSGITTRDDAEKYKKEGVHGFLVGEALMKSTDVKKFIHELCE

Gene Information

Entrez Gene ID
853669
Gene Name
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Gene Symbol
TRP3
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005950 IPI:SGD C anthranilate synthase complex
GO:0004049 IEA:UniProtKB-EC F anthranilate synthase activity
GO:0004425 IMP:SGD F indole-3-glycerol-phosphate synthase activity
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0006541 IEA:UniProtKB-KW P glutamine metabolic process
GO:0000162 IMP:SGD P tryptophan biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce01230 Biosynthesis of amino acids
sce_M00023 Tryptophan biosynthesis, chorismate => tryptophan

BIOCYC Pathway Links

BIOCYC Pathway ID Description
COMPLETE-ARO-YEAST-PWY superpathway of phenylalanine, tyrosine and tryptophan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR013785 Aldolase-type TIM barrel
IPR006221 Anthranilate synthase/para-aminobenzoate synthase like domain
IPR029062 Class I glutamine amidotransferase-like
IPR017926 Glutamine amidotransferase
IPR013798 Indole-3-glycerol phosphate synthase
IPR001468 Indole-3-glycerol phosphate synthase, conserved site
IPR011060 Ribulose-phosphate binding barrel

UniProt Annotations

Entry Information

Gene Name
bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase
Protein Entry
TRPG_YEAST
UniProt ID
P00937
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity 1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5- phosphate = 1-C-(3-indolyl)-glycerol 3-phosphate + CO(2) + H(2)O.
Catalytic Activity Chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate.
Induction By tryptophan starvation.
Interaction P00899:TRP2; NbExp=4; IntAct=EBI-19585, EBI-19575;
Miscellaneous Component I catalyzes the formation of anthranilate using ammonia rather than glutamine, whereas component II provides glutamine amidotransferase activity.
Miscellaneous Present with 13400 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Miscellaneous Yeast component II C-terminal half also has indole- 3-glycerol phosphate synthase activity.
Pathway Amino-acid biosynthesis; L-tryptophan biosynthesis; L- tryptophan from chorismate: step 1/5.
Pathway Amino-acid biosynthesis; L-tryptophan biosynthesis; L- tryptophan from chorismate: step 4/5.
Similarity Contains 1 glutamine amidotransferase type-1 domain. {ECO:0000255|PROSITE-ProRule:PRU00605}.
Subunit Tetramer of two components I and two components II.

Identical and Related Proteins

Unique RefSeq proteins for LMP006977 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6322638 RefSeq NP_012711 484 bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase

Identical Sequences to LMP006977 proteins

Reference Database Accession Length Protein Name
GI:6322638 DBBJ GAA24526.1 484 K7_Trp3p [Saccharomyces cerevisiae Kyokai no. 7]
GI:6322638 GenBank EIW09155.1 484 Trp3p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6322638 GenBank EWG84662.1 484 Trp3p [Saccharomyces cerevisiae R008]
GI:6322638 GenBank EWG89976.1 484 Trp3p [Saccharomyces cerevisiae P301]
GI:6322638 gnl McCuskerlabDuke 484 Trp3p [Saccharomyces cerevisiae YJM993]
GI:6322638 Third Party Genbank DAA08958.1 484 TPA: bifunctional anthranilate synthase/indole-3-glycerol-phosphate synthase [Saccharomyces cerevisiae S288c]

Related Sequences to LMP006977 proteins

Reference Database Accession Length Protein Name
GI:6322638 GenBank AAA35176.1 484 anthranilate synthase Component II:indole-3-glycerol phosphate synthase (TRP3) [Saccharomyces cerevisiae]
GI:6322638 GenBank EEU09210.1 484 Trp3p [Saccharomyces cerevisiae JAY291]
GI:6322638 GenBank EGA78105.1 466 Trp3p [Saccharomyces cerevisiae Vin13]
GI:6322638 GenBank EHN06007.1 484 Trp3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6322638 GenBank EJT42155.1 484 TRP3-like protein [Saccharomyces kudriavzevii IFO 1802]
GI:6322638 GenBank EWH17464.1 484 Trp3p [Saccharomyces cerevisiae P283]