Gene/Proteome Database (LMPD)

LMPD ID
LMP007022
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Gle1p
Gene Symbol
Synonyms
BRR3; NLE2; RSS1
Chromosome
IV

Proteins

Gle1p
Refseq ID NP_010074
Protein GI 6319994
UniProt ID Q12315
mRNA ID NM_001180267
Length 538
MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVGTKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPRASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLGKAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP

Gene Information

Entrez Gene ID
Gene Name
Gle1p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:SGD C cytoplasm
GO:0005643 IDA:SGD C nuclear pore
GO:0044614 IDA:SGD C nuclear pore cytoplasmic filaments
GO:0008047 IDA:SGD F enzyme activator activity
GO:0000822 IDA:SGD F inositol hexakisphosphate binding
GO:0005543 IDA:SGD F phospholipid binding
GO:0031369 IPI:SGD F translation initiation factor binding
GO:0006406 IMP:SGD P mRNA export from nucleus
GO:0006397 IEA:UniProtKB-KW P mRNA processing
GO:0016973 IMP:SGD P poly(A)+ mRNA export from nucleus
GO:0043085 IDA:GOC P positive regulation of catalytic activity
GO:0015031 IEA:UniProtKB-KW P protein transport
GO:0006446 IMP:SGD P regulation of translational initiation
GO:0006449 IMP:SGD P regulation of translational termination

Domain Information

InterPro Annotations

Accession Description
IPR012476 GLE1

UniProt Annotations

Entry Information

Gene Name
Gle1p
Protein Entry
GLE1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Function Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. It is specifically involved in a terminal step of poly(A)+ mRNA transport through the NPC probably by binding the ATP-dependent RNA helicase DBP5 and GFD1 at the cytoplasmic side of the NPC. These interactions are thought to be important for the dissociation of transport proteins such as the heterogeneous nuclear ribonuleoprotein (hnRNP) NAB2 from exported mRNA. {ECO:0000269|PubMed:10523319, ECO:0000269|PubMed:10610322, ECO:0000269|PubMed:10684247, ECO:0000269|PubMed:11336711, ECO:0000269|PubMed:15208322}.
Interaction P05453:SUP35; NbExp=2; IntAct=EBI-7635, EBI-6540;
Miscellaneous Present with 1040 molecules/cell in log phase SD medium
Miscellaneous Present with 1040 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the GLE1 family
Similarity Belongs to the GLE1 family. {ECO:0000305}.
Subcellular Location Nucleus, nuclear pore complex . Nucleus membrane ; Peripheral membrane protein ; Cytoplasmic side . Nucleus membrane ; Peripheral membrane protein ; Nucleoplasmic side . Note=Biased towards cytoplasmic side.
Subcellular Location Nucleus, nuclear pore complex {ECO:0000269|PubMed:10523319}. Nucleus membrane {ECO:0000269|PubMed:10523319}; Peripheral membrane protein {ECO:0000269|PubMed:10523319}; Cytoplasmic side {ECO:0000269|PubMed:10523319}. Nucleus membrane {ECO:0000269|PubMed:10523319}; Peripheral membrane protein {ECO:0000269|PubMed:10523319}; Nucleoplasmic side {ECO:0000269|PubMed:10523319}. Note=Biased towards cytoplasmic side.
Subunit The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active, nuclear transport receptor-mediated bidirectional transport of macromolecules such as proteins, RNAs, ribonucleoparticles (RNPs), and ribosomal subunits across the nuclear envelope. The 55-60 MDa NPC is composed of at least 31 different subunits: ASM4, CDC31, GLE1, GLE2, NDC1, NIC96, NSP1, NUP1, NUP2, NUP100, NUP116, NUP120, NUP133, NUP145, NUP157, NUP159, NUP170, NUP188, NUP192, NUP42, NUP49, NUP53, NUP57, NUP60, NUP82, NUP84, NUP85, POM152, POM34, SEH1 and SEC1. Due to its 8-fold rotational symmetry, all subunits are present with 8 copies or multiples thereof. GLE1 interacts with the NUP82 subcomplex (NSP1, NUP82, NUP159) via NUP42. It also interacts with GFD1 and the ATP-dependent RNA helicase DBP5
Subunit The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active, nuclear transport receptor-mediated bidirectional transport of macromolecules such as proteins, RNAs, ribonucleoparticles (RNPs), and ribosomal subunits across the nuclear envelope. The 55-60 MDa NPC is composed of at least 31 different subunits: ASM4, CDC31, GLE1, GLE2, NDC1, NIC96, NSP1, NUP1, NUP2, NUP100, NUP116, NUP120, NUP133, NUP145, NUP157, NUP159, NUP170, NUP188, NUP192, NUP42, NUP49, NUP53, NUP57, NUP60, NUP82, NUP84, NUP85, POM152, POM34, SEH1 and SEC1. Due to its 8-fold rotational symmetry, all subunits are present with 8 copies or multiples thereof. GLE1 interacts with the NUP82 subcomplex (NSP1, NUP82, NUP159) via NUP42. It also interacts with GFD1 and the ATP-dependent RNA helicase DBP5. {ECO:0000269|PubMed:10610322, ECO:0000269|PubMed:15208322}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007022 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6319994 RefSeq NP_010074 538 Gle1p

Identical Sequences to LMP007022 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007022 proteins

Reference Database Accession Length Protein Name