Gene/Proteome Database (LMPD)
Proteins
| bifunctional protein farnesyltransferase/protein geranylgeranyltransferase | |
|---|---|
| Refseq ID | NP_012906 |
| Protein GI | 398364711 |
| UniProt ID | P29703 |
| mRNA ID | NM_001179585 |
| Length | 316 |
| MEEYDYSDVKPLPIETDLQDELCRIMYTEDYKRLMGLARALISLNELSPRALQLTAEIIDVAPAFYTIWNYRFNIVRHMMSESEDTVLYLNKELDWLDEVTLNNPKNYQIWSYRQSLLKLHPSPSFKRELPILKLMIDDDSKNYHVWSYRKWCCLFFSDFQHELAYASDLIETDIYNNSAWTHRMFYWVNAKDVISKVELADELQFIMDKIQLVPQNISPWTYLRGFQELFHDRLQWDSKVVDFATTFIGDVLSLPIGSPEDLPEIESSYALEFLAYHWGADPCTRDNAVKAYSLLAIKYDPIRKNLWHHKINNLN | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional protein farnesyltransferase/protein geranylgeranyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005953 | IDA:SGD | C | CAAX-protein geranylgeranyltransferase complex |
| GO:0005965 | IDA:SGD | C | protein farnesyltransferase complex |
| GO:0004662 | IDA:SGD | F | CAAX-protein geranylgeranyltransferase activity |
| GO:0004660 | IDA:SGD | F | protein farnesyltransferase activity |
| GO:0004661 | IDA:SGD | F | protein geranylgeranyltransferase activity |
| GO:0007323 | IDA:SGD | P | peptide pheromone maturation |
| GO:0018343 | IDA:SGD | P | protein farnesylation |
| GO:0018344 | IDA:SGD | P | protein geranylgeranylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002088 | Protein prenyltransferase, alpha subunit |
UniProt Annotations
Entry Information
Gene Name
bifunctional protein farnesyltransferase/protein geranylgeranyltransferase
Protein Entry
FNTA_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Farnesyl diphosphate + protein-cysteine = S- farnesyl protein + diphosphate. |
| Catalytic Activity | Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. |
| Function | Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate. |
| Interaction | P18898:CDC43; NbExp=3; IntAct=EBI-14814, EBI-3961; P22007:RAM1; NbExp=4; IntAct=EBI-14814, EBI-14806; |
| Miscellaneous | Present with 396 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 396 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the protein prenyltransferase subunit alpha family |
| Similarity | Belongs to the protein prenyltransferase subunit alpha family. {ECO:0000305}. |
| Similarity | Contains 5 PFTA repeats. {ECO:0000255|PROSITE- ProRule:PRU00488}. |
| Subunit | Heterodimer of an alpha and a beta subunit. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007040 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 398364711 | RefSeq | NP_012906 | 316 | bifunctional protein farnesyltransferase/protein geranylgeranyltransferase |
Identical Sequences to LMP007040 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007040 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|