Gene/Proteome Database (LMPD)
Proteins
bifunctional protein farnesyltransferase/protein geranylgeranyltransferase | |
---|---|
Refseq ID | NP_012906 |
Protein GI | 398364711 |
UniProt ID | P29703 |
mRNA ID | NM_001179585 |
Length | 316 |
MEEYDYSDVKPLPIETDLQDELCRIMYTEDYKRLMGLARALISLNELSPRALQLTAEIIDVAPAFYTIWNYRFNIVRHMMSESEDTVLYLNKELDWLDEVTLNNPKNYQIWSYRQSLLKLHPSPSFKRELPILKLMIDDDSKNYHVWSYRKWCCLFFSDFQHELAYASDLIETDIYNNSAWTHRMFYWVNAKDVISKVELADELQFIMDKIQLVPQNISPWTYLRGFQELFHDRLQWDSKVVDFATTFIGDVLSLPIGSPEDLPEIESSYALEFLAYHWGADPCTRDNAVKAYSLLAIKYDPIRKNLWHHKINNLN |
Gene Information
Entrez Gene ID
Gene Name
bifunctional protein farnesyltransferase/protein geranylgeranyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005953 | IDA:SGD | C | CAAX-protein geranylgeranyltransferase complex |
GO:0005965 | IDA:SGD | C | protein farnesyltransferase complex |
GO:0004662 | IDA:SGD | F | CAAX-protein geranylgeranyltransferase activity |
GO:0004660 | IDA:SGD | F | protein farnesyltransferase activity |
GO:0004661 | IDA:SGD | F | protein geranylgeranyltransferase activity |
GO:0007323 | IDA:SGD | P | peptide pheromone maturation |
GO:0018343 | IDA:SGD | P | protein farnesylation |
GO:0018344 | IDA:SGD | P | protein geranylgeranylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002088 | Protein prenyltransferase, alpha subunit |
UniProt Annotations
Entry Information
Gene Name
bifunctional protein farnesyltransferase/protein geranylgeranyltransferase
Protein Entry
FNTA_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Farnesyl diphosphate + protein-cysteine = S- farnesyl protein + diphosphate. |
Catalytic Activity | Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. |
Function | Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate. |
Interaction | P18898:CDC43; NbExp=3; IntAct=EBI-14814, EBI-3961; P22007:RAM1; NbExp=4; IntAct=EBI-14814, EBI-14806; |
Miscellaneous | Present with 396 molecules/cell in log phase SD medium |
Miscellaneous | Present with 396 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the protein prenyltransferase subunit alpha family |
Similarity | Belongs to the protein prenyltransferase subunit alpha family. {ECO:0000305}. |
Similarity | Contains 5 PFTA repeats. {ECO:0000255|PROSITE- ProRule:PRU00488}. |
Subunit | Heterodimer of an alpha and a beta subunit. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007040 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
398364711 | RefSeq | NP_012906 | 316 | bifunctional protein farnesyltransferase/protein geranylgeranyltransferase |
Identical Sequences to LMP007040 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007040 proteins
Reference | Database | Accession | Length | Protein Name |
---|