Gene/Proteome Database (LMPD)
Proteins
| Tes1p | |
|---|---|
| Refseq ID | NP_012553 |
| Protein GI | 398364819 |
| UniProt ID | P41903 |
| mRNA ID | NM_001181677 |
| Length | 349 |
| MSASKMAMSNLEKILELVPLSPTSFVTKYLPAAPVGSKGTFGGTLVSQSLLASLHTVPLNFFPTSLHSYFIKGGDPRTKITYHVQNLRNGRNFIHKQVSAYQHDKLIFTSMILFAVQRSKEHDSLQHWETIPGLQGKQPDPHRYEEATSLFQKEVLDPQKLSRYASLSDRFQDATSMSKYVDAFQYGVMEYQFPKDMFYSARHTDELDYFVKVRPPITTVEHAGDESSLHKHHPYRIPKSITPENDARYNYVAFAYLSDSYLLLTIPYFHNLPLYCHSFSVSLDHTIYFHQLPHVNNWIYLKISNPRSHWDKHLVQGKYFDTQSGRIMASVSQEGYVVYGSERDIRAKF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005777 | IDA:SGD | C | peroxisome |
| GO:0047617 | IDA:SGD | F | acyl-CoA hydrolase activity |
| GO:0052689 | IEA:UniProtKB-KW | F | carboxylic ester hydrolase activity |
| GO:0016290 | IEA:UniProtKB-EC | F | palmitoyl-CoA hydrolase activity |
| GO:0006637 | IEA:InterPro | P | acyl-CoA metabolic process |
| GO:0006635 | IMP:SGD | P | fatty acid beta-oxidation |
| GO:0019395 | IMP:SGD | P | fatty acid oxidation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce01110 | Biosynthesis of secondary metabolites |
| ko01040 | Biosynthesis of unsaturated fatty acids |
| sce01040 | Biosynthesis of unsaturated fatty acids |
| ko00062 | Fatty acid elongation |
| sce00062 | Fatty acid elongation |
| sce01100 | Metabolic pathways |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-7053 | docosahexanoate biosynthesis I |
| PWY-7292 | oleate beta-oxidation (thioesterase-dependent) |
| PWY-7292 | oleate beta-oxidation (thioesterase-dependent, yeast) |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5618477 | Beta-oxidation of pristanoyl-CoA |
| 5618483 | Beta-oxidation of very long chain fatty acids |
| 5618352 | Bile acid and bile salt metabolism |
| 5618023 | Metabolism |
| 5618091 | Metabolism of lipids and lipoproteins |
| 5618473 | Peroxisomal lipid metabolism |
| 5618351 | Synthesis of bile acids and bile salts |
| 5618353 | Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol |
| 5618631 | alpha-linolenic (omega3) and linoleic (omega6) acid metabolism |
| 5618632 | alpha-linolenic acid (ALA) metabolism |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + H(2)O = CoA + palmitate. |
| Function | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. |
| Similarity | Belongs to the C/M/P thioester hydrolase family |
| Similarity | Belongs to the C/M/P thioester hydrolase family. {ECO:0000305}. |
| Subcellular Location | Peroxisome. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007060 (as displayed in Record Overview)
Identical Sequences to LMP007060 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007060 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|