Gene/Proteome Database (LMPD)
Proteins
Srf1p | |
---|---|
Refseq ID | NP_010149 |
Protein GI | 6320069 |
UniProt ID | Q12516 |
mRNA ID | NM_001180192 |
Length | 437 |
MGDSNSSQEAYSDTTSTNASRIADQNQLNLNVDLEKNQTVRKSGSLEALQNAKIHVPKHSDGSPLDYPKLNTYTFVPTTVPPYVLEAQFDKLRLQDKGTVDGNVTDDKNLPKEFKWGQFASTIGCHSAYTRDQNYNPSHKSYDGYSLSSSTSSKNAALREILGDMCSEWGGEERLEGVLHSEIGANLEFNTTEERKEWLQYIEKVKDFYYGDNKKNPESPESVHNKVYKSDWVNELNKEREKWRRLKQRKLQQWRPPLTSLLLDNQYLILGLRIFTGILSCISLALAIKIFQNSRSNNTISESKIGQQPSTIMAICVNAVAIAYIIYIAHDEFAGKPVGLRNPLSKLKLILLDLLFIIFSSANLALAFNTRFDKEWVCTSIRRSNGSTYGYPKIPRICRKQEALSAFLFVALFMWVITFSISIVRVVEKVSSITNRN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
GO:0043085 | IMP:SGD | P | positive regulation of catalytic activity |
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Regulator of phospholipase D (SPO14) which is required for SPO14 catalytic activity in mitotic cells. Essential to buffer the toxic effects of C16:0 platelet activating factor |
Function | Regulator of phospholipase D (SPO14) which is required for SPO14 catalytic activity in mitotic cells. Essential to buffer the toxic effects of C16:0 platelet activating factor. {ECO:0000269|PubMed:21347278}. |
Induction | During S phase of cell cycle |
Induction | During S phase of cell cycle. {ECO:0000269|PubMed:16278933}. |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Subunit | Interacts with SPO14 |
Subunit | Interacts with SPO14. {ECO:0000269|PubMed:21347278}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007107 (as displayed in Record Overview)
Identical Sequences to LMP007107 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007107 proteins
Reference | Database | Accession | Length | Protein Name |
---|