Gene/Proteome Database (LMPD)
Proteins
Gpi19p | |
---|---|
Refseq ID | NP_010725 |
Protein GI | 398366595 |
UniProt ID | Q04082 |
mRNA ID | NM_001180745 |
Length | 140 |
MYTKEYYWFSQYMIITSTLVLTIIWSILPSSLGEAAPKQFINTLLDIFPQRRWIITLESIMLMGMLCTYIGLLMYNEDTLTPPLDSLSTVTDAGGQLVIEDDPDVFVKKWAFKETSGIYDLSLMDACQLLYLYDNDHTST |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0000506 | IPI:SGD | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
GO:0030176 | IDA:SGD | C | integral component of endoplasmic reticulum membrane |
GO:0017176 | IEA:UniProtKB-EC | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
GO:0071555 | IEA:UniProtKB-KW | P | cell wall organization |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR013717 | PIG-P |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol. |
Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Involved in cell wall biosynthesis |
Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Involved in cell wall biosynthesis. {ECO:0000269|PubMed:16278447}. |
Miscellaneous | Present with 752 molecules/cell in log phase SD medium |
Miscellaneous | Present with 752 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
Similarity | Belongs to the GPI19 family |
Similarity | Belongs to the GPI19 family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Subunit | Component of the phosphatidylinositol N- acetylglucosaminyltransferase complex composed of at least GPI1, GPI2, GPI3, GPI15, GPI19 and ERI1 |
Subunit | Component of the phosphatidylinositol N- acetylglucosaminyltransferase complex composed of at least GPI1, GPI2, GPI3, GPI15, GPI19 and ERI1. {ECO:0000269|PubMed:16278447}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007134 (as displayed in Record Overview)
Identical Sequences to LMP007134 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007134 proteins
Reference | Database | Accession | Length | Protein Name |
---|