Gene/Proteome Database (LMPD)
Proteins
Brr6p | |
---|---|
Refseq ID | NP_011267 |
Protein GI | 6321190 |
UniProt ID | P53062 |
mRNA ID | NM_001181113 |
Length | 197 |
MELRSFSRQPDGILANPRLGREEVLEGEHPQDARLARQSIWLSPSLIAEYIQLFFNFIIGTIGLSLAIKFILMIRNDVNLKLEHNVREELDKIATCKSRYFENQCEPHMRVPALEVRCNEWSKCMNKEIVSGSDYQWAKAWARTLAEVINAFFEAFSIRSFLFILISIIGIIFVTNTSFGSYRVYLNNKDTKSVRHA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005635 | IDA:SGD | C | nuclear envelope |
GO:0031965 | IEA:InterPro | C | nuclear membrane |
GO:0044255 | IGI:SGD | P | cellular lipid metabolic process |
GO:0006406 | IMP:SGD | P | mRNA export from nucleus |
GO:0006998 | IEA:InterPro | P | nuclear envelope organization |
GO:0006611 | IMP:SGD | P | protein export from nucleus |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR018767 | Brl1/Brr6_dom |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Required for mRNA nuclear export. Involved in the nuclear pore complex (NPC) distribution and nuclear envelope morphology. {ECO:0000269|PubMed:11483521, ECO:0000269|PubMed:15882446}. |
Miscellaneous | Present with 125 molecules/cell in log phase SD medium |
Miscellaneous | Present with 125 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the BRL1/BRR6 family |
Similarity | Belongs to the BRL1/BRR6 family. {ECO:0000305}. |
Subcellular Location | Nucleus membrane {ECO:0000269|PubMed:11483521, ECO:0000269|PubMed:14562095}; Multi- pass membrane protein {ECO:0000269|PubMed:11483521, ECO:0000269|PubMed:14562095}. |
Subcellular Location | Nucleus membrane ; Multi- pass membrane protein {ECO:0000269|PubMed:11483521, ECO:0000269|PubMed:14562095}. |
Subunit | Interacts with BRL1 |
Subunit | Interacts with BRL1. {ECO:0000269|PubMed:15882446}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007148 (as displayed in Record Overview)
Identical Sequences to LMP007148 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007148 proteins
Reference | Database | Accession | Length | Protein Name |
---|