Gene/Proteome Database (LMPD)

LMPD ID
LMP007180
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit SUR1
Gene Symbol
Synonyms
BCL21; CSG1; LPE15
Chromosome
XVI
EC Number
2.4.-.-;

Proteins

mannosylinositol phosphorylceramide synthase catalytic subunit SUR1
Refseq ID NP_015268
Protein GI 6325200
UniProt ID P33300
mRNA ID NM_001183871
Length 382
MRKELKYLICFNILLLLSIIYYTFDLLTLCIDDTVKDAILEEDLNPDAPPKPQLIPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRKTSPLGVSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYYKMHSYSFFSITKGSSWHLDDAKLMKALENHILSCVVTGFIFGFFILYGEFTFYCWLCSKNFSNLTKNWKLNAIKVRFVTILNSLGLRLKLSKSTSDTASATLLARQQKRLRKDSNTNIVLLKSSRKSDVYDLEKNDSSKYSLGNNSS

Gene Information

Entrez Gene ID
Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit SUR1
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005622 IC:SGD C intracellular
GO:0000030 IMP:SGD F mannosyltransferase activity
GO:0016757 ISS:SGD F transferase activity, transferring glycosyl groups
GO:0006688 IMP:SGD P glycosphingolipid biosynthetic process
GO:0006675 IMP:SGD P mannosyl-inositol phosphorylceramide metabolic process
GO:0097502 IMP:GOC P mannosylation
GO:0030148 IMP:SGD P sphingolipid biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
SPHINGOLIPID-SYN-PWY sphingolipid biosynthesis
SPHINGOLIPID-SYN-PWY sphingolipid biosynthesis (yeast)

Domain Information

InterPro Annotations

Accession Description
IPR007577 Glycosyltransferase, DXD sugar-binding motif
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit SUR1
Protein Entry
SUR1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Function Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide. Suppressor of RVS161 mutation
Function Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide. Suppressor of RVS161 mutation. {ECO:0000269|PubMed:12954640}.
Similarity Belongs to the glycosyltransferase 32 family
Similarity Belongs to the glycosyltransferase 32 family. {ECO:0000305}.
Subcellular Location Membrane ; Multi-pass membrane protein .
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Subunit Heterodimer of SUR1 and CSG2
Subunit Heterodimer of SUR1 and CSG2. {ECO:0000269|PubMed:12954640}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007180 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6325200 RefSeq NP_015268 382 mannosylinositol phosphorylceramide synthase catalytic subunit SUR1

Identical Sequences to LMP007180 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007180 proteins

Reference Database Accession Length Protein Name