Gene/Proteome Database (LMPD)
Proteins
mannosylinositol phosphorylceramide synthase catalytic subunit SUR1 | |
---|---|
Refseq ID | NP_015268 |
Protein GI | 6325200 |
UniProt ID | P33300 |
mRNA ID | NM_001183871 |
Length | 382 |
MRKELKYLICFNILLLLSIIYYTFDLLTLCIDDTVKDAILEEDLNPDAPPKPQLIPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRKTSPLGVSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYYKMHSYSFFSITKGSSWHLDDAKLMKALENHILSCVVTGFIFGFFILYGEFTFYCWLCSKNFSNLTKNWKLNAIKVRFVTILNSLGLRLKLSKSTSDTASATLLARQQKRLRKDSNTNIVLLKSSRKSDVYDLEKNDSSKYSLGNNSS |
Gene Information
Entrez Gene ID
Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit SUR1
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005622 | IC:SGD | C | intracellular |
GO:0000030 | IMP:SGD | F | mannosyltransferase activity |
GO:0016757 | ISS:SGD | F | transferase activity, transferring glycosyl groups |
GO:0006688 | IMP:SGD | P | glycosphingolipid biosynthetic process |
GO:0006675 | IMP:SGD | P | mannosyl-inositol phosphorylceramide metabolic process |
GO:0097502 | IMP:GOC | P | mannosylation |
GO:0030148 | IMP:SGD | P | sphingolipid biosynthetic process |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
SPHINGOLIPID-SYN-PWY | sphingolipid biosynthesis |
SPHINGOLIPID-SYN-PWY | sphingolipid biosynthesis (yeast) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit SUR1
Protein Entry
SUR1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Function | Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide. Suppressor of RVS161 mutation |
Function | Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide. Suppressor of RVS161 mutation. {ECO:0000269|PubMed:12954640}. |
Similarity | Belongs to the glycosyltransferase 32 family |
Similarity | Belongs to the glycosyltransferase 32 family. {ECO:0000305}. |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Subunit | Heterodimer of SUR1 and CSG2 |
Subunit | Heterodimer of SUR1 and CSG2. {ECO:0000269|PubMed:12954640}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007180 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6325200 | RefSeq | NP_015268 | 382 | mannosylinositol phosphorylceramide synthase catalytic subunit SUR1 |
Identical Sequences to LMP007180 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007180 proteins
Reference | Database | Accession | Length | Protein Name |
---|