Gene/Proteome Database (LMPD)

LMPD ID
LMP007183
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Ost4p
Gene Symbol
Synonyms
-
Chromosome
IV
EC Number
2.4.99.18

Proteins

Ost4p
Refseq ID NP_010049
Protein GI 6319969
UniProt ID Q99380
mRNA ID NM_001180292
Length 36
MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN

Gene Information

Entrez Gene ID
Gene Name
Ost4p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IMP:SGD C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 IDA:UniProtKB C oligosaccharyltransferase complex
GO:0004579 IMP:UniProtKB F dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0030674 IDA:SGD F protein binding, bridging
GO:0006487 IMP:UniProtKB P protein N-linked glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
sce01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
sce00510 N-Glycan biosynthesis
M00072 N-glycosylation by oligosaccharyltransferase
sce_M00072 N-glycosylation by oligosaccharyltransferase
ko04141 Protein processing in endoplasmic reticulum
sce04141 Protein processing in endoplasmic reticulum
ko00513 Various types of N-glycan biosynthesis
sce00513 Various types of N-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR018943 Oligosaccaryltransferase

UniProt Annotations

Entry Information

Gene Name
Ost4p
Protein Entry
OST4_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. OST4 is required for recruitment of OST3 or OST6 to the OST complex. It is essential for cell growth at 37 but not at 25 degrees Celsius.
Interaction P48439:OST3; NbExp=2; IntAct=EBI-12689, EBI-12680; P52870:SBH1; NbExp=2; IntAct=EBI-12689, EBI-16410; P32915:SEC61; NbExp=2; IntAct=EBI-12689, EBI-16400; P35179:SSS1; NbExp=2; IntAct=EBI-12689, EBI-16406;
Miscellaneous Present with 2430 molecules/cell in log phase SD medium
Miscellaneous Present with 2430 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the OST4 family
Similarity Belongs to the OST4 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Single-pass type III membrane protein.
Subunit Component of the oligosaccharyltransferase (OST) complex, which appears to exist in two assemblies comprising OST1, OST2, OST4, OST5, STT3, SWP1, WPB1, and either OST3 or OST6. OST3, OST4 and STT3 probably form a subcomplex. May interact directly with OST2, OST3, OST5, OST6, STT3, WBP1 and SWP1. Interacts with SEC61, SBH1 and SSS1. {ECO:0000269|PubMed:10677492, ECO:0000269|PubMed:15831493, ECO:0000269|PubMed:15886282, ECO:0000269|PubMed:8175708, ECO:0000269|PubMed:9405463}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007183 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6319969 RefSeq NP_010049 36 Ost4p

Identical Sequences to LMP007183 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007183 proteins

Reference Database Accession Length Protein Name