Gene/Proteome Database (LMPD)
Proteins
| Asm4p | |
|---|---|
| Refseq ID | NP_010195 |
| Protein GI | 6320115 |
| UniProt ID | Q05166 |
| mRNA ID | NM_001180147 |
| Length | 528 |
| RefSeq Status | PROVISIONAL |
| MFGIRSGNNNGGFTNLTSQAPQTTQMFQSQSQLQPQPQPQPQQQQQHLQFNGSSDASSLRFGNSLSNTVNANNYSSNIGNNSINNNNIKNGTNNISQHGQGNNPSWVNNPKKRFTPHTVIRRKTTKQNSSSDINQNDDSSSMNATMRNFSKQNQDSKHNERNKSAANNDINSLLSNFNDIPPSVTLQDWQREDEFGSIPSLTTQFVTDKYTAKKTNRSAYDSKNTPNVFDKDSYVRIANIEQNHLDNNYNTAETNNKVHETSSKSSSLSAIIVFGYPESISNELIEHFSHFGHIMEDFQVLRLGRGINPNTFRIFHNHDTGCDENDSTVNKSITLKGRNNESNNKKYPIFTGESWVKLTYNSPSSALRALQENGTIFRGSLIGCIPYSKNAVEQLAGCKIDNVDDIGEFNVSMYQNSSTSSTSNTPSPPNVIITDGTLLREDDNTPAGHAGNPTNISSPIVANSPNKRLDVIDGKLPFMQNAGPNSNIPNLLRNLESKMRQQEAKYRNNEPAGFTHKLSNWLFGWNDL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005643 | IDA:SGD | C | nuclear pore |
| GO:0044613 | IDA:SGD | C | nuclear pore central transport channel |
| GO:0005487 | IPI:SGD | F | nucleocytoplasmic transporter activity |
| GO:0005543 | IDA:SGD | F | phospholipid binding |
| GO:0003697 | IDA:SGD | F | single-stranded DNA binding |
| GO:0031990 | IMP:SGD | P | mRNA export from nucleus in response to heat stress |
| GO:0007067 | IEA:UniProtKB-KW | P | mitotic nuclear division |
| GO:0007094 | IMP:SGD | P | mitotic spindle assembly checkpoint |
| GO:0006999 | IGI:SGD | P | nuclear pore organization |
| GO:0015031 | IEA:UniProtKB-KW | P | protein transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007846 | RNA-recognition motif (RRM) Nup35-type domain |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Domain | Contains FG repeats. FG repeats are interaction sites for karyopherins (importins, exportins) and form probably an affinity gradient, guiding the transport proteins unidirectionally with their cargo through the NPC. FG repeat regions are highly flexible and lack ordered secondary structure. The overall conservation of FG repeats regarding exact sequence, spacing, and repeat unit length is limited. FG repeat types and their physico-chemical environment change across the NPC from the nucleoplasmic to the cytoplasmic side. |
| Domain | The RRM Nup35-type domain might be involved in the control of mitosis. |
| Function | Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Active directional transport is assured by both, a Phe-Gly (FG) repeat affinity gradient for these transport factors across the NPC and a transport cofactor concentration gradient across the nuclear envelope (GSP1 and GSP2 GTPases associated predominantly with GTP in the nucleus, with GDP in the cytoplasm). May have a mitosis control function (By similarity). {ECO:0000250}. |
| Interaction | P32500:NDC1; NbExp=3; IntAct=EBI-3035, EBI-11950; |
| Miscellaneous | Present with 2740 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Ptm | Phosphorylated by CDC28. {ECO:0000269|PubMed:14574415, ECO:0000269|PubMed:19779198}. |
| Similarity | Contains 1 RRM Nup35-type domain. {ECO:0000255|PROSITE-ProRule:PRU00804}. |
| Subcellular Location | Nucleus, nuclear pore complex. Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side. Note=Symmetric distribution. |
| Subunit | The nuclear pore complex (NPC) constitutes the exclusive means of nucleocytoplasmic transport. NPCs allow the passive diffusion of ions and small molecules and the active, nuclear transport receptor-mediated bidirectional transport of macromolecules such as proteins, RNAs, ribonucleoparticles (RNPs), and ribosomal subunits across the nuclear envelope. The 55-60 MDa NPC is composed of at least 31 different subunits: ASM4, CDC31, GLE1, GLE2, NDC1, NIC96, NSP1, NUP1, NUP2, NUP100, NUP116, NUP120, NUP133, NUP145, NUP157, NUP159, NUP170, NUP188, NUP192, NUP42, NUP49, NUP53, NUP57, NUP60, NUP82, NUP84, NUP85, POM152, POM34, SEH1 and SEC1. Due to its 8-fold rotational symmetry, all subunits are present with 8 copies or multiples thereof. ASM4 may form a subcomplex with NUP53, NDC1, and NUP170. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007188 (as displayed in Record Overview)
Identical Sequences to LMP007188 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6320115 | EMBL | CAA64923.1 | 528 | ASM4 [Saccharomyces cerevisiae] |
| GI:6320115 | EMBL | CAA98654.1 | 528 | ASM4 [Saccharomyces cerevisiae] |
| GI:6320115 | GenBank | AAV19840.1 | 528 | Sequence 100 from patent US 6753314 |
| GI:6320115 | SwissProt | Q05166.1 | 528 | RecName: Full=Nucleoporin ASM4; AltName: Full=Nuclear pore protein NUP59 [Saccharomyces cerevisiae S288c] |
| GI:6320115 | Third Party Genbank | DAA11770.1 | 528 | TPA: Asm4p [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007188 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6320115 | GenBank | AAT92991.1 | 528 | YDL088C [Saccharomyces cerevisiae] |
| GI:6320115 | GenBank | EDZ73315.1 | 528 | YDL088Cp-like protein [Saccharomyces cerevisiae AWRI1631] |
| GI:6320115 | GenBank | EEU08989.1 | 528 | Asm4p [Saccharomyces cerevisiae JAY291] |
| GI:6320115 | GenBank | EIW11119.1 | 528 | Asm4p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6320115 | GenBank | EWG91703.1 | 528 | Asm4p [Saccharomyces cerevisiae P301] |
| GI:6320115 | GenBank | EWG96915.1 | 528 | Asm4p [Saccharomyces cerevisiae R103] |