Gene/Proteome Database (LMPD)
Proteins
Tim12p | |
---|---|
Refseq ID | NP_009649 |
Protein GI | 6319567 |
UniProt ID | P32830 |
mRNA ID | NM_001178439 |
Length | 109 |
RefSeq Status | PROVISIONAL |
MSFFLNSLRGNQEVSQEKLDVAGVQFDAMCSTFNNILSTCLEKCIPHEGFGEPDLTKGEQCCIDRCVAKMHYSNRLIGGFVQTRGFGPENQLRHYSRFVAKEIADDSKK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005743 | TAS:Reactome | C | mitochondrial inner membrane |
GO:0042721 | IDA:SGD | C | mitochondrial inner membrane protein insertion complex |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0005543 | IDA:SGD | F | phospholipid binding |
GO:0045039 | IDA:SGD | P | protein import into mitochondrial inner membrane |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Domain | The twin CX3C motif contains 4 conserved Cys residues that form 2 disulfide bonds in the mitochondrial intermembrane space. However, during the transit of TIM12 from cytoplasm into mitochondrion, the Cys residues probably coordinate zinc, thereby preventing folding and allowing its transfer across mitochondrial outer membrane (By similarity). {ECO:0000250}. |
Function | Essential component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as external driving force. In the TIM22 complex, it acts as a docking point for the soluble TIM9-TIM10 heterohexamer that guides the target proteins in transit through the aqueous mitochondrial intermembrane space. {ECO:0000269|PubMed:10369662, ECO:0000269|PubMed:10995434, ECO:0000269|PubMed:8663351, ECO:0000269|PubMed:9430585, ECO:0000269|PubMed:9495346}. |
Interaction | P16892:FUS3; NbExp=2; IntAct=EBI-11303, EBI-7193; P87108:TIM10; NbExp=2; IntAct=EBI-11303, EBI-9115; |
Similarity | Belongs to the small Tim family. {ECO:0000305}. |
Subcellular Location | Mitochondrion inner membrane {ECO:0000269|PubMed:8663351, ECO:0000269|PubMed:9495346}; Peripheral membrane protein {ECO:0000269|PubMed:8663351, ECO:0000269|PubMed:9495346}. |
Subunit | Component of the TIM22 complex, whose core is composed of TIM18, TIM22 and TIM54, associated with the peripheral proteins MRS5/TIM12 and the 70 kDa heterohexamer composed of TIM9 and TIM10 (or TIM8 and TIM13). Interacts directly with both the TIM22 protein and the TIM9-TIM10 heterohexamer. Interacts with multi- pass transmembrane proteins in transit. {ECO:0000269|PubMed:10648604, ECO:0000269|PubMed:12637749, ECO:0000269|PubMed:8955274, ECO:0000269|PubMed:9430585, ECO:0000269|PubMed:9495346, ECO:0000269|PubMed:9889188}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007241 (as displayed in Record Overview)
Identical Sequences to LMP007241 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6319567 | GenBank | EIW12020.1 | 109 | Tim12p [Saccharomyces cerevisiae CEN.PK113-7D] |
GI:6319567 | GenBank | EWG87673.1 | 109 | Tim12p [Saccharomyces cerevisiae R008] |
GI:6319567 | GenBank | EWG92448.1 | 109 | Tim12p [Saccharomyces cerevisiae P301] |
GI:6319567 | GenBank | EWG97531.1 | 109 | Tim12p [Saccharomyces cerevisiae R103] |
GI:6319567 | GenBank | EWH19494.1 | 109 | Tim12p [Saccharomyces cerevisiae P283] |
GI:6319567 | gnl | McCuskerlabDuke | 109 | Tim12p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP007241 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6319567 | EMBL | CCC71793.1 | 108 | hypothetical protein NCAS_0I01250 [Naumovozyma castellii CBS 4309] |
GI:6319567 | EMBL | CCD22929.1 | 106 | hypothetical protein NDAI_0A07750 [Naumovozyma dairenensis CBS 421] |
GI:6319567 | EMBL | CCF59197.1 | 110 | hypothetical protein KAFR_0G01630 [Kazachstania africana CBS 2517] |
GI:6319567 | GenBank | EJT44169.1 | 109 | TIM12-like protein [Saccharomyces kudriavzevii IFO 1802] |
GI:6319567 | RefSeq | XP_003678137.1 | 108 | hypothetical protein NCAS_0I01250 [Naumovozyma castellii CBS 4309] |
GI:6319567 | RefSeq | XP_003958332.1 | 110 | hypothetical protein KAFR_0G01630 [Kazachstania africana CBS 2517] |