Gene/Proteome Database (LMPD)

LMPD ID
LMP007245
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
fatty acid elongase ELO2
Gene Symbol
Synonyms
FEN1; GNS1; VBM2
Alternate Names
fatty acid elongase ELO2
Chromosome
III
EC Number
2.3.1.199

Proteins

fatty acid elongase ELO2
Refseq ID NP_009963
Protein GI 6319882
UniProt ID P25358
mRNA ID NM_001178748
Length 347
RefSeq Status PROVISIONAL
MNSLVTQYAAPLFERYPQLHDYLPTLERPFFNISLWEHFDDVVTRVTNGRFVPSEFQFIAGELPLSTLPPVLYAITAYYVIIFGGRFLLSKSKPFKLNGLFQLHNLVLTSLSLTLLLLMVEQLVPIIVQHGLYFAICNIGAWTQPLVTLYYMNYIVKFIEFIDTFFLVLKHKKLTFLHTYHHGATALLCYTQLMGTTSISWVPISLNLGVHVVMYWYYFLAARGIRVWWKEWVTRFQIIQFVLDIGFIYFAVYQKAVHLYFPILPHCGDCVGSTTATFAGCAIISSYLVLFISFYINVYKRKGTKTSRVVKRAHGGVAAKVNEYVNVDLKNVPTPSPSPKPQHRRKR

Gene Information

Entrez Gene ID
Gene Name
fatty acid elongase ELO2
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:SGD C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0009922 IMP:SGD F fatty acid elongase activity
GO:0030497 IMP:SGD P fatty acid elongation
GO:0030148 IMP:SGD P sphingolipid biosynthetic process
GO:0016192 IMP:SGD P vesicle-mediated transport

KEGG Pathway Links

KEGG Pathway ID Description
sce01040 Biosynthesis of unsaturated fatty acids
sce_M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
sce00062 Fatty acid elongation

REACTOME Pathway Links

REACTOME Pathway ID Description
5618630 Linoleic acid (LA) metabolism

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
fatty acid elongase ELO2
Protein Entry
ELO2_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). {ECO:0000269|PubMed:12684876}.
Domain The C-terminal di-lysine-like motif may confer endoplasmic reticulum localization. {ECO:0000303|PubMed:9832547}.
Function Component of a microsomal membrane-bound long-chain fatty acid elongation system, which produces the 20-26-carbon very long-chain fatty acids (VLCFA) from long-chain fatty acid precursors and is involved ceramide and inositol sphingolipid biosynthesis. Component of elongase II, which elongates 16-18 carbon fatty acyl-CoAs such as palmitoyl-CoA and stearoyl-CoA to 20-22-carbon fatty acids by incorporation of malonyl-CoA (PubMed:9211877, PubMed:12684876). Involved in the synthesis of 1,3-beta-glucan (PubMed:7768822). {ECO:0000269|PubMed:12684876, ECO:0000269|PubMed:7768822, ECO:0000269|PubMed:9211877}.
Interaction Q05359:ERP1; NbExp=1; IntAct=EBI-6415, EBI-6581; P54837:ERV25; NbExp=1; IntAct=EBI-6415, EBI-6642; P38264:PHO88; NbExp=1; IntAct=EBI-6415, EBI-13350; P06197:PIS1; NbExp=1; IntAct=EBI-6415, EBI-13458; P39986:SPF1; NbExp=1; IntAct=EBI-6415, EBI-3128; P38992:SUR2; NbExp=1; IntAct=EBI-6415, EBI-18574; Q02795:SWP1; NbExp=1; IntAct=EBI-6415, EBI-12666; P38800:YHR080C; NbExp=1; IntAct=EBI-6415, EBI-24597;
Miscellaneous Present with 3510 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the ELO family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:9832547}; Multi- pass membrane protein {ECO:0000255}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007245 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6319882 RefSeq NP_009963 347 fatty acid elongase ELO2

Identical Sequences to LMP007245 proteins

Reference Database Accession Length Protein Name
GI:6319882 GenBank EWG92245.1 347 Fen1p [Saccharomyces cerevisiae P301]
GI:6319882 GenBank EWG97279.1 347 Fen1p [Saccharomyces cerevisiae R103]
GI:6319882 GenBank EWH19283.1 347 Fen1p [Saccharomyces cerevisiae P283]
GI:6319882 GenBank AHN96094.1 347 FEN1 [synthetic construct]
GI:6319882 GenBank AHV79297.1 347 FEN1 [synthetic construct]
GI:6319882 gnl McCuskerlabDuke 347 Fen1p [Saccharomyces cerevisiae YJM993]

Related Sequences to LMP007245 proteins

Reference Database Accession Length Protein Name
GI:6319882 EMBL CAY78240.1 347 Fen1p [Saccharomyces cerevisiae EC1118]
GI:6319882 GenBank EGA59562.1 347 Fen1p [Saccharomyces cerevisiae FostersB]
GI:6319882 GenBank EGA83807.1 347 Fen1p [Saccharomyces cerevisiae Lalvin QA23]
GI:6319882 GenBank EHN03441.1 347 Fen1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6319882 GenBank EJS44510.1 347 fen1p [Saccharomyces arboricola H-6]
GI:6319882 GenBank EJT43932.1 347 FEN1-like protein [Saccharomyces kudriavzevii IFO 1802]