Gene/Proteome Database (LMPD)
Proteins
fatty acid elongase ELO2 | |
---|---|
Refseq ID | NP_009963 |
Protein GI | 6319882 |
UniProt ID | P25358 |
mRNA ID | NM_001178748 |
Length | 347 |
RefSeq Status | PROVISIONAL |
MNSLVTQYAAPLFERYPQLHDYLPTLERPFFNISLWEHFDDVVTRVTNGRFVPSEFQFIAGELPLSTLPPVLYAITAYYVIIFGGRFLLSKSKPFKLNGLFQLHNLVLTSLSLTLLLLMVEQLVPIIVQHGLYFAICNIGAWTQPLVTLYYMNYIVKFIEFIDTFFLVLKHKKLTFLHTYHHGATALLCYTQLMGTTSISWVPISLNLGVHVVMYWYYFLAARGIRVWWKEWVTRFQIIQFVLDIGFIYFAVYQKAVHLYFPILPHCGDCVGSTTATFAGCAIISSYLVLFISFYINVYKRKGTKTSRVVKRAHGGVAAKVNEYVNVDLKNVPTPSPSPKPQHRRKR |
Gene Information
Entrez Gene ID
Gene Name
fatty acid elongase ELO2
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0009922 | IMP:SGD | F | fatty acid elongase activity |
GO:0030497 | IMP:SGD | P | fatty acid elongation |
GO:0030148 | IMP:SGD | P | sphingolipid biosynthetic process |
GO:0016192 | IMP:SGD | P | vesicle-mediated transport |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
sce01040 | Biosynthesis of unsaturated fatty acids |
sce_M00415 | Fatty acid biosynthesis, elongation, endoplasmic reticulum |
sce00062 | Fatty acid elongation |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5618630 | Linoleic acid (LA) metabolism |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). {ECO:0000269|PubMed:12684876}. |
Domain | The C-terminal di-lysine-like motif may confer endoplasmic reticulum localization. {ECO:0000303|PubMed:9832547}. |
Function | Component of a microsomal membrane-bound long-chain fatty acid elongation system, which produces the 20-26-carbon very long-chain fatty acids (VLCFA) from long-chain fatty acid precursors and is involved ceramide and inositol sphingolipid biosynthesis. Component of elongase II, which elongates 16-18 carbon fatty acyl-CoAs such as palmitoyl-CoA and stearoyl-CoA to 20-22-carbon fatty acids by incorporation of malonyl-CoA (PubMed:9211877, PubMed:12684876). Involved in the synthesis of 1,3-beta-glucan (PubMed:7768822). {ECO:0000269|PubMed:12684876, ECO:0000269|PubMed:7768822, ECO:0000269|PubMed:9211877}. |
Interaction | Q05359:ERP1; NbExp=1; IntAct=EBI-6415, EBI-6581; P54837:ERV25; NbExp=1; IntAct=EBI-6415, EBI-6642; P38264:PHO88; NbExp=1; IntAct=EBI-6415, EBI-13350; P06197:PIS1; NbExp=1; IntAct=EBI-6415, EBI-13458; P39986:SPF1; NbExp=1; IntAct=EBI-6415, EBI-3128; P38992:SUR2; NbExp=1; IntAct=EBI-6415, EBI-18574; Q02795:SWP1; NbExp=1; IntAct=EBI-6415, EBI-12666; P38800:YHR080C; NbExp=1; IntAct=EBI-6415, EBI-24597; |
Miscellaneous | Present with 3510 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the ELO family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:9832547}; Multi- pass membrane protein {ECO:0000255}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007245 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6319882 | RefSeq | NP_009963 | 347 | fatty acid elongase ELO2 |
Identical Sequences to LMP007245 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6319882 | GenBank | EWG92245.1 | 347 | Fen1p [Saccharomyces cerevisiae P301] |
GI:6319882 | GenBank | EWG97279.1 | 347 | Fen1p [Saccharomyces cerevisiae R103] |
GI:6319882 | GenBank | EWH19283.1 | 347 | Fen1p [Saccharomyces cerevisiae P283] |
GI:6319882 | GenBank | AHN96094.1 | 347 | FEN1 [synthetic construct] |
GI:6319882 | GenBank | AHV79297.1 | 347 | FEN1 [synthetic construct] |
GI:6319882 | gnl | McCuskerlabDuke | 347 | Fen1p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP007245 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6319882 | EMBL | CAY78240.1 | 347 | Fen1p [Saccharomyces cerevisiae EC1118] |
GI:6319882 | GenBank | EGA59562.1 | 347 | Fen1p [Saccharomyces cerevisiae FostersB] |
GI:6319882 | GenBank | EGA83807.1 | 347 | Fen1p [Saccharomyces cerevisiae Lalvin QA23] |
GI:6319882 | GenBank | EHN03441.1 | 347 | Fen1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
GI:6319882 | GenBank | EJS44510.1 | 347 | fen1p [Saccharomyces arboricola H-6] |
GI:6319882 | GenBank | EJT43932.1 | 347 | FEN1-like protein [Saccharomyces kudriavzevii IFO 1802] |