Gene/Proteome Database (LMPD)
Proteins
delta(14)-sterol reductase | |
---|---|
Refseq ID | NP_014119 |
Protein GI | 6324049 |
UniProt ID | P32462 |
mRNA ID | NM_001183118 |
Length | 438 |
MVSALNPRTTEFEFGGLIGALGISIGLPVFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKPLRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQLRDGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCIISILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLGPLDIKMFSELRPGMLLWLLINLSCLHHHYLKTGKINDALVLVNFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLSVSPVELGWVKVVGILAIMFLGFHIFHSANKQKSEFRQGKLENLKSIQTKRGTKLLCDGWWAKSQHINYFGDWLISLSWCLATWFQTPLTYYYSLYFATLLLHRQQRDEHKCRLKYGENWEEYERKVPYKIIPYVY |
Gene Information
Entrez Gene ID
Gene Name
delta(14)-sterol reductase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0050613 | IDA:SGD | F | delta14-sterol reductase activity |
GO:0006696 | IMP:SGD | P | ergosterol biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
sce01110 | Biosynthesis of secondary metabolites |
sce01100 | Metabolic pathways |
ko00100 | Steroid biosynthesis |
sce00100 | Steroid biosynthesis |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis |
ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis I |
PWY-6074 | zymosterol biosynthesis |
PWY-6074 | zymosterol biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta(14)-sterol reductase
Protein Entry
ERG24_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 4,4-dimethyl-5-alpha-cholesta-8,24-dien-3- beta-ol + NADP(+) = 4,4-dimethyl-5-alpha-cholesta-8,14,24-trien-3- beta-ol + NADPH. |
Enzyme Regulation | Inhibited by the morpholine antifungal drug fenpropimorph. |
Function | Reduces the C14=C15 double bond of 4,4-dimethyl- cholesta-8,14,24-trienol to produce 4,4-dimethyl-cholesta-8,24- dienol. |
Miscellaneous | Present with 1600 molecules/cell in log phase SD medium |
Miscellaneous | Present with 1600 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 2/6. |
Similarity | Belongs to the ERG4/ERG24 family |
Similarity | Belongs to the ERG4/ERG24 family. {ECO:0000305}. |
Subcellular Location | Membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007255 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6324049 | RefSeq | NP_014119 | 438 | delta(14)-sterol reductase |
Identical Sequences to LMP007255 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007255 proteins
Reference | Database | Accession | Length | Protein Name |
---|