Gene/Proteome Database (LMPD)
Proteins
| delta(14)-sterol reductase | |
|---|---|
| Refseq ID | NP_014119 |
| Protein GI | 6324049 |
| UniProt ID | P32462 |
| mRNA ID | NM_001183118 |
| Length | 438 |
| MVSALNPRTTEFEFGGLIGALGISIGLPVFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKPLRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQLRDGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCIISILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLGPLDIKMFSELRPGMLLWLLINLSCLHHHYLKTGKINDALVLVNFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLSVSPVELGWVKVVGILAIMFLGFHIFHSANKQKSEFRQGKLENLKSIQTKRGTKLLCDGWWAKSQHINYFGDWLISLSWCLATWFQTPLTYYYSLYFATLLLHRQQRDEHKCRLKYGENWEEYERKVPYKIIPYVY | |
Gene Information
Entrez Gene ID
Gene Name
delta(14)-sterol reductase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0050613 | IDA:SGD | F | delta14-sterol reductase activity |
| GO:0006696 | IMP:SGD | P | ergosterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce01110 | Biosynthesis of secondary metabolites |
| sce01100 | Metabolic pathways |
| ko00100 | Steroid biosynthesis |
| sce00100 | Steroid biosynthesis |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis |
| ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis I |
| PWY-6074 | zymosterol biosynthesis |
| PWY-6074 | zymosterol biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta(14)-sterol reductase
Protein Entry
ERG24_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 4,4-dimethyl-5-alpha-cholesta-8,24-dien-3- beta-ol + NADP(+) = 4,4-dimethyl-5-alpha-cholesta-8,14,24-trien-3- beta-ol + NADPH. |
| Enzyme Regulation | Inhibited by the morpholine antifungal drug fenpropimorph. |
| Function | Reduces the C14=C15 double bond of 4,4-dimethyl- cholesta-8,14,24-trienol to produce 4,4-dimethyl-cholesta-8,24- dienol. |
| Miscellaneous | Present with 1600 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 1600 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 2/6. |
| Similarity | Belongs to the ERG4/ERG24 family |
| Similarity | Belongs to the ERG4/ERG24 family. {ECO:0000305}. |
| Subcellular Location | Membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007255 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6324049 | RefSeq | NP_014119 | 438 | delta(14)-sterol reductase |
Identical Sequences to LMP007255 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007255 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|