Gene/Proteome Database (LMPD)

LMPD ID
LMP007255
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
delta(14)-sterol reductase
Gene Symbol
Synonyms
-
Chromosome
XIV
EC Number
1.3.1.70

Proteins

delta(14)-sterol reductase
Refseq ID NP_014119
Protein GI 6324049
UniProt ID P32462
mRNA ID NM_001183118
Length 438
MVSALNPRTTEFEFGGLIGALGISIGLPVFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKPLRYYLGNRELWTVYCLWYGILAVLDVILPGRVMKGVQLRDGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCIISILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLGPLDIKMFSELRPGMLLWLLINLSCLHHHYLKTGKINDALVLVNFLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLSVSPVELGWVKVVGILAIMFLGFHIFHSANKQKSEFRQGKLENLKSIQTKRGTKLLCDGWWAKSQHINYFGDWLISLSWCLATWFQTPLTYYYSLYFATLLLHRQQRDEHKCRLKYGENWEEYERKVPYKIIPYVY

Gene Information

Entrez Gene ID
Gene Name
delta(14)-sterol reductase
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0050613 IDA:SGD F delta14-sterol reductase activity
GO:0006696 IMP:SGD P ergosterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce01110 Biosynthesis of secondary metabolites
sce01100 Metabolic pathways
ko00100 Steroid biosynthesis
sce00100 Steroid biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
ERGOSTEROL-SYN-PWY superpathway of ergosterol biosynthesis
ERGOSTEROL-SYN-PWY superpathway of ergosterol biosynthesis I
PWY-6074 zymosterol biosynthesis
PWY-6074 zymosterol biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5618606 Activation of gene expression by SREBF (SREBP)
5618346 Cholesterol biosynthesis
5618023 Metabolism
5618091 Metabolism of lipids and lipoproteins
5618607 Regulation of cholesterol biosynthesis by SREBP (SREBF)

Domain Information

InterPro Annotations

Accession Description
IPR001171 Ergosterol biosynthesis ERG4/ERG24
IPR018083 Sterol reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
delta(14)-sterol reductase
Protein Entry
ERG24_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity 4,4-dimethyl-5-alpha-cholesta-8,24-dien-3- beta-ol + NADP(+) = 4,4-dimethyl-5-alpha-cholesta-8,14,24-trien-3- beta-ol + NADPH.
Enzyme Regulation Inhibited by the morpholine antifungal drug fenpropimorph.
Function Reduces the C14=C15 double bond of 4,4-dimethyl- cholesta-8,14,24-trienol to produce 4,4-dimethyl-cholesta-8,24- dienol.
Miscellaneous Present with 1600 molecules/cell in log phase SD medium
Miscellaneous Present with 1600 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 2/6.
Similarity Belongs to the ERG4/ERG24 family
Similarity Belongs to the ERG4/ERG24 family. {ECO:0000305}.
Subcellular Location Membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP007255 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6324049 RefSeq NP_014119 438 delta(14)-sterol reductase

Identical Sequences to LMP007255 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007255 proteins

Reference Database Accession Length Protein Name