Gene/Proteome Database (LMPD)
Proteins
inositol monophosphate 1-phosphatase INM2 | |
---|---|
Refseq ID | NP_010573 |
Protein GI | 398366417 |
UniProt ID | Q05533 |
mRNA ID | NM_001180595 |
Length | 292 |
MVLTRQVLEEVENTFIELLRSKIGPLVKSHAGTNFCSYDDKANGVDLVTALDKQIESIIKENLTAKYPSFKFIGEETYVKGVTKITNGPTFIVDPIDGTTNFIHGYPYSCTSLGLAEMGKPVVGVVFNPHLNQLFHASKGNGAFLNDQEIKVSKRPLILQKSLIALEGGSERTEGSQGNFDKKMNTYKNLLSESGAFVHGFRSAGSAAMNICYVASGMLDAYWEGGCWAWDVCAGWCILEEAGGIMVGGNCGEWNIPLDRRCYLAIRGGCESMEQKRFAESFWPHVAGELEY |
Gene Information
Entrez Gene ID
Gene Name
inositol monophosphate 1-phosphatase INM2
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008934 | IDA:SGD | F | inositol monophosphate 1-phosphatase activity |
GO:0052832 | IEA:UniProtKB-EC | F | inositol monophosphate 3-phosphatase activity |
GO:0052833 | IEA:UniProtKB-EC | F | inositol monophosphate 4-phosphatase activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0006021 | IEA:UniProtKB-UniPathway | P | inositol biosynthetic process |
GO:0046855 | IDA:SGD | P | inositol phosphate dephosphorylation |
GO:0046854 | IEA:InterPro | P | phosphatidylinositol phosphorylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
sce01110 | Biosynthesis of secondary metabolites |
ko00562 | Inositol phosphate metabolism |
sce00562 | Inositol phosphate metabolism |
sce01100 | Metabolic pathways |
ko04070 | Phosphatidylinositol signaling system |
sce04070 | Phosphatidylinositol signaling system |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-2301 | myo-inositol biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
inositol monophosphate 1-phosphatase INM2
Protein Entry
INM2_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | Kinetic parameters: KM=0.12 mM for inositol 1-phosphate {ECO:0000269|PubMed:10096091}; Vmax=16 umol/min/mg enzyme for inositol 1-phosphate {ECO:0000269|PubMed:10096091}; |
Biophysicochemical Properties | Kinetic parameters: KM=0.12 mM for inositol 1-phosphate ; Vmax=16 umol/min/mg enzyme for inositol 1-phosphate ; |
Catalytic Activity | Myo-inositol phosphate + H(2)O = myo-inositol + phosphate. |
Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; |
Enzyme Regulation | Inhibited by Li(+) and Na(+) |
Enzyme Regulation | Inhibited by Li(+) and Na(+). {ECO:0000269|PubMed:10096091}. |
Function | Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and involved in the inositol cycle of calcium signaling |
Function | Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and involved in the inositol cycle of calcium signaling. {ECO:0000269|PubMed:10096091, ECO:0000269|PubMed:12593845}. |
Pathway | Polyol metabolism; myo-inositol biosynthesis; myo- inositol from D-glucose 6-phosphate: step 2/2. |
Similarity | Belongs to the inositol monophosphatase family |
Similarity | Belongs to the inositol monophosphatase family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007270 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
398366417 | RefSeq | NP_010573 | 292 | inositol monophosphate 1-phosphatase INM2 |
Identical Sequences to LMP007270 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007270 proteins
Reference | Database | Accession | Length | Protein Name |
---|