Gene/Proteome Database (LMPD)
Proteins
Env9p | |
---|---|
Refseq ID | NP_014889 |
Protein GI | 398365915 |
UniProt ID | Q08651 |
mRNA ID | NM_001183665 |
Length | 330 |
MLDPRILPYYDPAVERKIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDDGSSPGAGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVPLEMTKDGFEVQLQTNYISHFIFTMRLLPLLRHCRGRIISLSSIGHHLEFMYWKLSKTWDYKPNMLFTWFRYAMSKTALIQCTKMLAIKYPDVLCLSVHPGLVMNTNLFSYWTRLPIVGIFFWLLFQVVGFFFGVSNEQGSLASLKCALDPNLSVEKDNGKYFTTGGKESKSSYVSNNVDEAASTWIWTVHQLRDRGFDI |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005811 | IEA:UniProtKB-KW | C | lipid particle |
GO:0016491 | ISS:SGD | F | oxidoreductase activity |
GO:0006624 | IMP:SGD | P | vacuolar protein processing |
GO:0007033 | IMP:SGD | P | vacuole organization |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Disruption Phenotype | Exhibits lumenal vesicles within vacuoles suggestive of vacuole fusion/fission defects. Leads to internal accumulation of precursor CPY |
Disruption Phenotype | Exhibits lumenal vesicles within vacuoles suggestive of vacuole fusion/fission defects. Leads to internal accumulation of precursor CPY. {ECO:0000269|PubMed:21912603}. |
Function | Probable dehydrogenase required for replication of Brome mosaic virus. Involved in vacuolar processing and morphology |
Function | Probable dehydrogenase required for replication of Brome mosaic virus. Involved in vacuolar processing and morphology. {ECO:0000269|PubMed:14671320, ECO:0000269|PubMed:21912603}. |
Miscellaneous | Present with 892 molecules/cell in log phase SD medium |
Miscellaneous | Present with 892 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Ptm | N-glycosylated |
Ptm | N-glycosylated. {ECO:0000269|PubMed:19756047}. |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}. |
Subcellular Location | Lipid droplet . Membrane {ECO:0000305}; Multi-pass membrane protein . |
Subcellular Location | Lipid droplet {ECO:0000269|PubMed:14562095}. Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007283 (as displayed in Record Overview)
Identical Sequences to LMP007283 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007283 proteins
Reference | Database | Accession | Length | Protein Name |
---|