Gene/Proteome Database (LMPD)
Proteins
3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) | |
---|---|
Refseq ID | NP_012868 |
Protein GI | 6322795 |
UniProt ID | P35731 |
mRNA ID | NM_001179621 |
Length | 278 |
RefSeq Status | PROVISIONAL |
MHYLPVAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQCAIAIDFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQESLSVRTTASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNLPVEAKEMLERTIGASGTSAPAEIAEEVWSLYSRTALET |
Gene Information
Entrez Gene ID
Gene Name
3-oxoacyl-[acyl-carrier-protein] reductase (NADPH)
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IMP:SGD | C | mitochondrion |
GO:0004316 | IDA:SGD | F | 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity |
GO:0009060 | IMP:SGD | P | aerobic respiration |
GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
GO:0006631 | IMP:SGD | P | fatty acid metabolic process |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-7388 | octanoyl-ACP biosynthesis (mitochondria) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
3-oxoacyl-[acyl-carrier-protein] reductase (NADPH)
Protein Entry
FABG_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Catalytic Activity | (3R)-3-hydroxyacyl-[acyl-carrier-protein] + NADP(+) = 3-oxoacyl-[acyl-carrier-protein] + NADPH. |
Function | Involved in biosynthesis of fatty acids in mitochondria. {ECO:0000250}. |
Miscellaneous | Present with 1760 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}. |
Subcellular Location | Mitochondrion {ECO:0000269|PubMed:14562095}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007291 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6322795 | RefSeq | NP_012868 | 278 | 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) |
Identical Sequences to LMP007291 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6322795 | GenBank | EHN06131.1 | 278 | Oar1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
GI:6322795 | GenBank | EIW09181.1 | 278 | Oar1p [Saccharomyces cerevisiae CEN.PK113-7D] |
GI:6322795 | GenBank | EWG84794.1 | 278 | Oar1p [Saccharomyces cerevisiae R008] |
GI:6322795 | GenBank | EWG90096.1 | 278 | Oar1p [Saccharomyces cerevisiae P301] |
GI:6322795 | GenBank | EWH17325.1 | 278 | Oar1p [Saccharomyces cerevisiae P283] |
GI:6322795 | gnl | McCuskerlabDuke | 278 | Oar1p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP007291 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6322795 | PDB | 4FD3 | 286 | Chain B, Crystal Structure Of Apo-formed Ymtoar1 |
GI:6322795 | PDB | 4FD3 | 286 | Chain C, Crystal Structure Of Apo-formed Ymtoar1 |
GI:6322795 | PDB | 4FD3 | 286 | Chain D, Crystal Structure Of Apo-formed Ymtoar1 |
GI:6322795 | PDB | 4FD3 | 286 | Chain E, Crystal Structure Of Apo-formed Ymtoar1 |
GI:6322795 | PDB | 4FD3 | 286 | Chain F, Crystal Structure Of Apo-formed Ymtoar1 |
GI:6322795 | PDB | 4HBG | 286 | Chain A, Crystal Structure Of Saccharomyces Cerevisiae 3 Oxoacyl-[acyl Carrier Protein]-reductase Complexed With Nadph (form2) |