Gene/Proteome Database (LMPD)

LMPD ID
LMP007339
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Ypi1p
Gene Symbol
Synonyms
-
Chromosome
VI

Proteins

Ypi1p
Refseq ID NP_116658
Protein GI 14318525
UniProt ID P43587
mRNA ID NM_001179968
Length 155
MSGNQMAMGSEQQQTVGSRTVSVEEVPAVLQLRATQDPPRSQEAMPTRHNVRWEENVIDNENMNKKKTKICCIFHPQNEDEEECNHHSDDDGSSSSGSSSSESENEKDLDFNERRQRRLERRHRKLEKKRSYSPNAYEIQPDYSEYRRKQQEKKD

Gene Information

Entrez Gene ID
Gene Name
Ypi1p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IDA:SGD C nucleus
GO:0071862 IGI:SGD F protein phosphatase type 1 activator activity
GO:0004865 IDA:SGD F protein serine/threonine phosphatase inhibitor activity
GO:0006873 IMP:SGD P cellular ion homeostasis
GO:0005977 IMP:SGD P glycogen metabolic process
GO:0007094 IGI:SGD P mitotic spindle assembly checkpoint
GO:0032515 IDA:SGD P negative regulation of phosphoprotein phosphatase activity
GO:0035308 IDA:SGD P negative regulation of protein dephosphorylation
GO:0032516 IGI:SGD P positive regulation of phosphoprotein phosphatase activity
GO:1900180 IDA:SGD P regulation of protein localization to nucleus

Domain Information

InterPro Annotations

Accession Description
IPR011107 PPI_Ypi1

UniProt Annotations

Entry Information

Gene Name
Ypi1p
Protein Entry
YPI1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Caution Was originally (PubMed:14506263) thought to be an inhibitor of type 1 phosphatases using in vitro experiments, but further in vivo experiments (PubMed:18172024) showed that it was rather an activator of these phosphatases
Caution Was originally (PubMed:14506263) thought to be an inhibitor of type 1 phosphatases using in vitro experiments, but further in vivo experiments (PubMed:18172024) showed that it was rather an activator of these phosphatases. {ECO:0000305|PubMed:14506263, ECO:0000305|PubMed:18172024}.
Function Regulator of type 1 phosphatases which maintains protein phosphatase activity under strict control. Regulates the nuclear localization of type 1 phosphatase GLC7 and SDS22, and is involved in the regulation of mRNA 3'-end processing. May also regulate the activity of type 1 phosphatase PPZ1. {ECO:0000269|PubMed:14506263, ECO:0000269|PubMed:16137619, ECO:0000269|PubMed:17142459, ECO:0000269|PubMed:18172024}.
Interaction P32598:GLC7; NbExp=4; IntAct=EBI-22913, EBI-13715; P36047:SDS22; NbExp=4; IntAct=EBI-22913, EBI-16783;
Miscellaneous Present with 1080 molecules/cell in log phase SD medium
Miscellaneous Present with 1080 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the YPI1 family
Similarity Belongs to the YPI1 family. {ECO:0000305}.
Subcellular Location Nucleus {ECO:0000269|PubMed:17142459, ECO:0000269|PubMed:18172024}.
Subunit Interacts with GLC7, PPZ1 and SDS22. {ECO:0000269|PubMed:14506263, ECO:0000269|PubMed:17142459, ECO:0000269|PubMed:18172024}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007339 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
14318525 RefSeq NP_116658 155 Ypi1p

Identical Sequences to LMP007339 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007339 proteins

Reference Database Accession Length Protein Name