Gene/Proteome Database (LMPD)
Proteins
Eeb1p | |
---|---|
Refseq ID | NP_015230 |
Protein GI | 6325162 |
UniProt ID | Q02891 |
mRNA ID | NM_001183909 |
Length | 456 |
MFRSGYYPTVTPSHWGYNGTVKHVLGEKGTKSLAFRDSKRQIPLHEFVTKHVPTLKDGANFRLNSLLFTGYLQTLYLSAGDFSKKFQVFYGREIIKFSDGGVCTADWVMPEWEQTYSLNAEKASFNEKQFSNDEKATHPKGWPRLHPRTRYLSSEELEKCHSKGYSYPLVVVLHGLAGGSHEPLIRALSEDLSKVGDGKFQVVVLNARGCSRSKVTTRRIFTALHTGDVREFLNHQKALFPQRKIYAVGTSFGAAMLTNYLGEEGDNCPLNAAVALSNPWDFVHTWDKLAHDWWSNHIFSRTLTQFLTRTVKVNMNELQVPENFEVSHKPTVEKPVFYTYTRENLEKAEKFTDILEFDNLFTAPSMGLPDGLTYYRKASSINRLPNIKIPTLIINATDDPVTGENVIPYKQARENPCVLLCETDLGGHLAYLDNESNSWLTKQAAEFLGSFDELVL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0004026 | IEA:UniProtKB-EC | F | alcohol O-acetyltransferase activity |
GO:0034321 | IDA:SGD | F | alcohol O-octanoyltransferase activity |
GO:0034338 | IDA:SGD | F | short-chain carboxylesterase activity |
GO:0051792 | IDA:SGD | P | medium-chain fatty acid biosynthetic process |
GO:0051793 | IMP:SGD | P | medium-chain fatty acid catabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acetyl-CoA + an alcohol = CoA + an acetyl ester. |
Function | Displays enzymatic activity both for medium-chain fatty acid (MCFA) ethyl ester synthesis and hydrolysis (esterase activity). MCFA are toxic for yeast and this enzyme could thus be involved in their detoxification by esterification |
Function | Displays enzymatic activity both for medium-chain fatty acid (MCFA) ethyl ester synthesis and hydrolysis (esterase activity). MCFA are toxic for yeast and this enzyme could thus be involved in their detoxification by esterification. {ECO:0000269|PubMed:16361250}. |
Interaction | P53039:YIP1; NbExp=1; IntAct=EBI-29462, EBI-25295; P53093:YIP4; NbExp=1; IntAct=EBI-29462, EBI-24124; |
Miscellaneous | Present with 573 molecules/cell in log phase SD medium |
Miscellaneous | Present with 573 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the AB hydrolase superfamily. AB hydrolase 4 family |
Similarity | Belongs to the AB hydrolase superfamily. AB hydrolase 4 family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007394 (as displayed in Record Overview)
Identical Sequences to LMP007394 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007394 proteins
Reference | Database | Accession | Length | Protein Name |
---|