Gene/Proteome Database (LMPD)

LMPD ID
LMP007401
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Ost5p
Gene Symbol
Synonyms
-
Chromosome
VII
EC Number
2.4.99.18

Proteins

Ost5p
Refseq ID NP_011288
Protein GI 6321211
UniProt ID Q92316
mRNA ID NM_001181091
Length 86
MTYEQLYKEFHSSKSFQPFIHLDTQPKFAICGLIVTLAVLSSALFAVGSKSSYIKKLFFYTILSVIGSLFAGLTTVFASNSFGVYV

Gene Information

Entrez Gene ID
Gene Name
Ost5p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 IPI:SGD C oligosaccharyltransferase complex
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0006487 IPI:SGD P protein N-linked glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
sce01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
sce00510 N-Glycan biosynthesis
M00072 N-glycosylation by oligosaccharyltransferase
sce_M00072 N-glycosylation by oligosaccharyltransferase
ko04141 Protein processing in endoplasmic reticulum
sce04141 Protein processing in endoplasmic reticulum
ko00513 Various types of N-glycan biosynthesis
sce00513 Various types of N-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR020294 OST5

UniProt Annotations

Entry Information

Gene Name
Ost5p
Protein Entry
OST5_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.
Miscellaneous Present with 1010 molecules/cell in log phase SD medium
Miscellaneous Present with 1010 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the OST5 family
Similarity Belongs to the OST5 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Subunit Component of the oligosaccharyltransferase (OST) complex, which appears to exist in two assemblies comprising OST1, OST2, OST4, OST5, STT3, SWP1, WPB1, and either OST3 or OST6. OST1 and OST5 probably form a subcomplex. Ma interact directly with OST1, OST2 and OST4. {ECO:0000269|PubMed:8175708, ECO:0000269|PubMed:9405463}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007401 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6321211 RefSeq NP_011288 86 Ost5p

Identical Sequences to LMP007401 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007401 proteins

Reference Database Accession Length Protein Name