Gene/Proteome Database (LMPD)

LMPD ID
LMP007415
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
sterol 14-demethylase
Gene Symbol
Synonyms
CYP51
Alternate Names
sterol 14-demethylase
Chromosome
VIII
EC Number
1.14.13.70

Proteins

sterol 14-demethylase
Refseq ID NP_011871
Protein GI 6321795
UniProt ID P10614
mRNA ID NM_001179137
Length 530
RefSeq Status PROVISIONAL
MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIVWQLLYSLRKDRPPLVFYWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMRAKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTSMVTLPTGPAKIIWEKRNPEQKI

Gene Information

Entrez Gene ID
Gene Name
sterol 14-demethylase
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:SGD C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0008398 IDA:SGD F sterol 14-demethylase activity
GO:0070988 IDA:GOC P demethylation
GO:0006696 IMP:SGD P ergosterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5618346 Cholesterol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR017972 Cytochrome P450, conserved site
IPR002403 Cytochrome P450, E-class, group IV

UniProt Annotations

Entry Information

Gene Name
sterol 14-demethylase
Protein Entry
CP51_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity A 14-alpha-methylsteroid + 3 O(2) + 3 NADPH = a Delta(14)-steroid + formate + 3 NADP(+) + 4 H(2)O.
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence={ECO:0000250};
Function Catalyzes C14-demethylation of lanosterol which is critical for ergosterol biosynthesis. It transforms lanosterol into 4,4'-dimethyl cholesta-8,14,24-triene-3-beta-ol.
Interaction P53045:ERG25; NbExp=3; IntAct=EBI-5127, EBI-6506;
Miscellaneous It is the main target for antifungal compounds of the triazole family like ketoconazole which inhibits by coordinating the iron atom at the sixth ligand position.
Miscellaneous Present with 73200 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 1/6.
Similarity Belongs to the cytochrome P450 family. {ECO:0000305}.
Subcellular Location Membrane; Single-pass membrane protein.
Subunit Interacts with ERG28. {ECO:0000269|PubMed:15995173}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007415 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6321795 RefSeq NP_011871 530 sterol 14-demethylase

Identical Sequences to LMP007415 proteins

Reference Database Accession Length Protein Name
GI:6321795 GenBank EHN06848.1 530 Erg11p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6321795 GenBank EIW10154.1 530 Erg11p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6321795 GenBank EWG85650.1 530 Erg11p [Saccharomyces cerevisiae R008]
GI:6321795 GenBank EWG90593.1 530 Erg11p [Saccharomyces cerevisiae P301]
GI:6321795 GenBank EWG95625.1 530 Erg11p [Saccharomyces cerevisiae R103]
GI:6321795 GenBank EWH18045.1 530 Erg11p [Saccharomyces cerevisiae P283]

Related Sequences to LMP007415 proteins

Reference Database Accession Length Protein Name
GI:6321795 GenBank AAA34546.1 530 lanosterol 14-demethylase cytochrome P450 [Saccharomyces cerevisiae]
GI:6321795 GenBank EDN62241.1 530 lanosterol 14-alpha demethylase [Saccharomyces cerevisiae YJM789]
GI:6321795 GenBank EEU07922.1 530 Erg11p [Saccharomyces cerevisiae JAY291]
GI:6321795 gnl McCuskerlabDuke 530 Erg11p [Saccharomyces cerevisiae YJM993]
GI:6321795 PDB 4K0F 539 Chain A, Crystal Structure Of Lanosterol 14-alpha Demethylase With Intact Transmembrane Domain Bound To Itraconazole
GI:6321795 PDB 4LXJ 536 Chain A, Saccharomyces Cerevisiae Lanosterol 14-alpha Demethylase With Lanosterol Bound