Gene/Proteome Database (LMPD)
Proteins
Scs22p | |
---|---|
Refseq ID | NP_009461 |
Protein GI | 41629673 |
UniProt ID | Q6Q595 |
mRNA ID | NM_001184321 |
Length | 175 |
RefSeq Status | PROVISIONAL |
MRIVPEKLVFKAPLNKQSTEYIKLENDGEKRVIFKVRTSAPTKYCVRPNVAIIGAHESVNVQIVFLGLPKSTADDEMDQKRDKFLIVTLPIPAAYQNVEDGELLSDWPNLEEQYKDDIVFKKIKIFHSVLPKRKPSGNHDAESARAPSAGNGQSLSSRALLIITVIALLVGWIYY |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005198 | IEA:InterPro | F | structural molecule activity |
GO:0090158 | IGI:SGD | P | endoplasmic reticulum membrane organization |
GO:0008654 | IGI:SGD | P | phospholipid biosynthetic process |
GO:0060304 | IGI:SGD | P | regulation of phosphatidylinositol dephosphorylation |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Domain | The MSP domain is required for binding to the FFAT motif of target proteins. {ECO:0000250}. |
Function | Targets proteins containing a FFAT motif to membranes (By similarity). Involved in regulation of phospholipid metabolism. {ECO:0000250, ECO:0000269|PubMed:15668246}. |
Miscellaneous | Present with 358 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. {ECO:0000305}. |
Similarity | Contains 1 MSP domain. {ECO:0000255|PROSITE- ProRule:PRU00132}. |
Subcellular Location | Membrane {ECO:0000305}; Single-pass type IV membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007434 (as displayed in Record Overview)
Identical Sequences to LMP007434 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:41629673 | GenBank | EDV12176.1 | 175 | conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a] |
GI:41629673 | GenBank | EIW11970.1 | 175 | Scs22p [Saccharomyces cerevisiae CEN.PK113-7D] |
GI:41629673 | GenBank | EWH19349.1 | 175 | Scs22p [Saccharomyces cerevisiae P283] |
GI:41629673 | SwissProt | Q6Q595.2 | 175 | RecName: Full=Vesicle-associated membrane protein-associated protein SCS22; Short=VAMP-associated protein SCS22; AltName: Full=VAP homolog 2 [Saccharomyces cerevisiae S288c] |
GI:41629673 | Third Party Genbank | DAA07032.1 | 175 | TPA: Scs22p [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007434 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:41629673 | DBBJ | GAA21464.1 | 175 | K7_Scs22p [Saccharomyces cerevisiae Kyokai no. 7] |
GI:41629673 | EMBL | CAY77692.1 | 175 | Scs22p [Saccharomyces cerevisiae EC1118] |
GI:41629673 | GenBank | EDN64530.1 | 175 | suppressor of choline sensitivity [Saccharomyces cerevisiae YJM789] |
GI:41629673 | GenBank | EEU06265.1 | 176 | Scs22p [Saccharomyces cerevisiae JAY291] |
GI:41629673 | gnl | McCuskerlabDuke | 175 | Scs22p [Saccharomyces cerevisiae YJM993] |
GI:41629673 | PIR | - | 99 | protein YBL091c-a - yeast (Saccharomyces cerevisiae) [Saccharomyces cerevisiae] |