Gene/Proteome Database (LMPD)
Proteins
Ost1p | |
---|---|
Refseq ID | NP_012532 |
Protein GI | 398364715 |
UniProt ID | P41543 |
mRNA ID | NM_001181436 |
Length | 476 |
MRQVWFSWIVGLFLCFFNVSSAAQYEPPATWENVDYKRTIDVSNAYISETIEITIKNIASEPATEYFTAFESGIFSKVSFFSAYFTNEATFLNSQLLANSTTAPGDDGESEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGMSEEQHLLWETNRLPLSAYDTKKASFTLIGSSSFEEYHPPNDESLLGKANGNSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWASTIQFEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGATDHYFTDLVGLVSTSHAERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLHVSSGSDEKFVASIPILNGPPDTVYDNVELSVFLPEGAEIFDIDSPVPFTNVSIETQKSYFDLNKGHVKLTFSYRNLISQVANGQVLIKYDYPKSSFFKKPLSIACYIFTALMGVFVLKTLNMNVTN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008250 | IPI:SGD | C | oligosaccharyltransferase complex |
GO:0004579 | IDA:SGD | F | dolichyl-diphosphooligosaccharide-protein glycotransferase activity |
GO:0042802 | IPI:IntAct | F | identical protein binding |
GO:0006487 | IDA:SGD | P | protein N-linked glycosylation |
GO:0018279 | IPI:SGD | P | protein N-linked glycosylation via asparagine |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
sce01100 | Metabolic pathways |
ko00510 | N-Glycan biosynthesis |
sce00510 | N-Glycan biosynthesis |
M00072 | N-glycosylation by oligosaccharyltransferase |
sce_M00072 | N-glycosylation by oligosaccharyltransferase |
ko04141 | Protein processing in endoplasmic reticulum |
sce04141 | Protein processing in endoplasmic reticulum |
ko00513 | Various types of N-glycan biosynthesis |
sce00513 | Various types of N-glycan biosynthesis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007676 | Ribophorin_I |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine. |
Function | Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. |
Interaction | Self; NbExp=2; IntAct=EBI-12651, EBI-12651; P35179:SSS1; NbExp=2; IntAct=EBI-12651, EBI-16406; |
Miscellaneous | Present with 11900 molecules/cell in log phase SD medium |
Miscellaneous | Present with 11900 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the OST1 family |
Similarity | Belongs to the OST1 family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane; Single-pass type I membrane protein. |
Subunit | Component of the oligosaccharyltransferase (OST) complex, which appears to exist in two assemblies comprising OST1, OST2, OST4, OST5, STT3, SWP1, WPB1, and either OST3 or OST6. OST1 and OST5 probably form a subcomplex. OST1 may interact directly with OST2 OST3, OST5, OST6, WBP1 AND SWP1. Interacts with SEC61, SBH1 and SSS1. {ECO:0000269|PubMed:15831493, ECO:0000269|PubMed:15886282, ECO:0000269|PubMed:8175708, ECO:0000269|PubMed:9405463}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007479 (as displayed in Record Overview)
Identical Sequences to LMP007479 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007479 proteins
Reference | Database | Accession | Length | Protein Name |
---|