Gene/Proteome Database (LMPD)

LMPD ID
LMP007479
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Ost1p
Gene Symbol
Synonyms
NLT1
Chromosome
X
EC Number
2.4.99.18

Proteins

Ost1p
Refseq ID NP_012532
Protein GI 398364715
UniProt ID P41543
mRNA ID NM_001181436
Length 476
MRQVWFSWIVGLFLCFFNVSSAAQYEPPATWENVDYKRTIDVSNAYISETIEITIKNIASEPATEYFTAFESGIFSKVSFFSAYFTNEATFLNSQLLANSTTAPGDDGESEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGMSEEQHLLWETNRLPLSAYDTKKASFTLIGSSSFEEYHPPNDESLLGKANGNSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWASTIQFEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGATDHYFTDLVGLVSTSHAERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLHVSSGSDEKFVASIPILNGPPDTVYDNVELSVFLPEGAEIFDIDSPVPFTNVSIETQKSYFDLNKGHVKLTFSYRNLISQVANGQVLIKYDYPKSSFFKKPLSIACYIFTALMGVFVLKTLNMNVTN

Gene Information

Entrez Gene ID
Gene Name
Ost1p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 IPI:SGD C oligosaccharyltransferase complex
GO:0004579 IDA:SGD F dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0042802 IPI:IntAct F identical protein binding
GO:0006487 IDA:SGD P protein N-linked glycosylation
GO:0018279 IPI:SGD P protein N-linked glycosylation via asparagine

KEGG Pathway Links

KEGG Pathway ID Description
sce01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
sce00510 N-Glycan biosynthesis
M00072 N-glycosylation by oligosaccharyltransferase
sce_M00072 N-glycosylation by oligosaccharyltransferase
ko04141 Protein processing in endoplasmic reticulum
sce04141 Protein processing in endoplasmic reticulum
ko00513 Various types of N-glycan biosynthesis
sce00513 Various types of N-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR007676 Ribophorin_I

UniProt Annotations

Entry Information

Gene Name
Ost1p
Protein Entry
OST1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.
Interaction Self; NbExp=2; IntAct=EBI-12651, EBI-12651; P35179:SSS1; NbExp=2; IntAct=EBI-12651, EBI-16406;
Miscellaneous Present with 11900 molecules/cell in log phase SD medium
Miscellaneous Present with 11900 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the OST1 family
Similarity Belongs to the OST1 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Subunit Component of the oligosaccharyltransferase (OST) complex, which appears to exist in two assemblies comprising OST1, OST2, OST4, OST5, STT3, SWP1, WPB1, and either OST3 or OST6. OST1 and OST5 probably form a subcomplex. OST1 may interact directly with OST2 OST3, OST5, OST6, WBP1 AND SWP1. Interacts with SEC61, SBH1 and SSS1. {ECO:0000269|PubMed:15831493, ECO:0000269|PubMed:15886282, ECO:0000269|PubMed:8175708, ECO:0000269|PubMed:9405463}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007479 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398364715 RefSeq NP_012532 476 Ost1p

Identical Sequences to LMP007479 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007479 proteins

Reference Database Accession Length Protein Name