LIPID MAPS

LMPD ID

LMP007480

Gene ID

Species

Saccharomyces cerevisiae S288c (Yeast (S288c))

Gene Name

protein SHH3

Gene Symbol

SHH3

Synonyms

-

Chromosome

XIII

protein SHH3
Refseq ID	NP_013836
Protein GI	6323765
UniProt ID	Q04487
mRNA ID	NM_001182618
Length	196
MKATIQRVTSVFGVPRASVFVPRISTPFILHNYISNGRMDLFSKEFHNGRVSKSDLWSSNKEEELLVSQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALGFYAFTITLGVTTIMGMDTTFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNRGVIKTGSIVLAGTLVLGTYLLAQ

Entrez Gene ID

Gene Name

protein SHH3

Gene Symbol

SHH3

Species

Saccharomyces cerevisiae S288c

GO ID	Source	Type	Description
GO:0016021	IEA:UniProtKB-KW	C	integral component of membrane
GO:0005743	IEA:UniProtKB-KW	C	mitochondrial inner membrane
GO:0045281	IEA:InterPro	C	succinate dehydrogenase complex
GO:0009055	IEA:InterPro	F	electron carrier activity
GO:0046872	IEA:UniProtKB-KW	F	metal ion binding
GO:0048038	IEA:UniProtKB-KW	F	quinone binding
GO:0000104	IEA:InterPro	F	succinate dehydrogenase activity
GO:0006099	IEA:UniProtKB-KW	P	tricarboxylic acid cycle

KEGG Pathway ID	Description
sce01110	Biosynthesis of secondary metabolites
ko01200	Carbon metabolism
sce01200	Carbon metabolism
M00011	Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce_M00011	Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ko00020	Citrate cycle (TCA cycle)
sce00020	Citrate cycle (TCA cycle)
M00009	Citrate cycle (TCA cycle, Krebs cycle)
sce_M00009	Citrate cycle (TCA cycle, Krebs cycle)
sce01100	Metabolic pathways
ko00190	Oxidative phosphorylation
sce00190	Oxidative phosphorylation
M00148	Succinate dehydrogenase (ubiquinone)
sce_M00148	Succinate dehydrogenase (ubiquinone)

REACTOME Pathway ID	Description
5618051	Citric acid cycle (TCA cycle)
5618023	Metabolism
5618052	Pyruvate metabolism and Citric Acid (TCA) cycle
5618290	Respiratory electron transport
5618291	Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
5618053	The citric acid (TCA) cycle and respiratory electron transport

Gene Name

protein SHH3

Protein Entry

SHH3_YEAST

UniProt ID

Species

Yeast (S288c)

Comment Type	Description
Disruption Phenotype	Does not affect SDH or TIM22 complex formation
Disruption Phenotype	Does not affect SDH or TIM22 complex formation. {ECO:0000269\|PubMed:22152483}.
Function	Homolog of SDH3, but seems not to be a stoichiometric subunit of either the succinate dehydrogenase (SDH) complex or the mitochondrial inner membrane translocase TIM22 complex
Function	Homolog of SDH3, but seems not to be a stoichiometric subunit of either the succinate dehydrogenase (SDH) complex or the mitochondrial inner membrane translocase TIM22 complex. {ECO:0000303\|PubMed:22152483}.
Similarity	Belongs to the cytochrome b560 family
Similarity	Belongs to the cytochrome b560 family. {ECO:0000305}.
Subcellular Location	Mitochondrion inner membrane {ECO:0000250\|UniProtKB:P33421}; Multi-pass membrane protein {ECO:0000255}.
Subcellular Location	Mitochondrion inner membrane ; Multi-pass membrane protein .