Gene/Proteome Database (LMPD)

LMPD ID
LMP007492
Gene ID
853159
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
succinate--CoA ligase (GDP-forming) subunit beta
Gene Symbol
LSC2
Synonyms
-
Chromosome
VII
EC Number
6.2.1.5

Proteins

succinate--CoA ligase (GDP-forming) subunit beta
Refseq ID NP_011760
Protein GI 398366275
UniProt ID P53312
mRNA ID NM_001181373
Length 427
MYSRKSLSLISKCGQLSRLNAQAALQARRHLSIHEYRSAQLLREYGIGTPEGFPAFTPEEAFEAAKKLNTNKLVIKAQALTGGRGKGHFDTGYKSGVHMIESPQQAEDVAKEMLNHNLITKQTGIAGKPVSAVYIVKRVDTKHEAYLSILMDRQTKKPMIIASSQGGMNIEEVAERTPDAIKKFSIETSKGLSPQMAKDVAKSLGFSPDAQDEAAKAVSNLYKIFMERDATQVEINPLSEIEHDPTHKIMCTDAKFGFDDNASFRQEKIYSWRDLSQEDPDEVKAKKYDLNFVKLKGNIGCLVNGAGLAMATMDVIKLNGGDPANFLDCGGGATPETIKQGFELILSNKNVDAIFVNIFGGIVRCDYVALGLVEAARELEVRVPIVARLQGTKVEEGRDIINKSGVKIYSFDELDPAAKKVVELTQN

Gene Information

Entrez Gene ID
853159
Gene Name
succinate--CoA ligase (GDP-forming) subunit beta
Gene Symbol
LSC2
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:SGD C mitochondrion
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0004775 IDA:SGD F succinate-CoA ligase (ADP-forming) activity
GO:0006104 IDA:SGD P succinyl-CoA metabolic process
GO:0006099 TAS:SGD P tricarboxylic acid cycle

KEGG Pathway Links

KEGG Pathway ID Description
sce01110 Biosynthesis of secondary metabolites
ko01200 Carbon metabolism
sce01200 Carbon metabolism
ko00020 Citrate cycle (TCA cycle)
sce00020 Citrate cycle (TCA cycle)
M00009 Citrate cycle (TCA cycle, Krebs cycle)
sce_M00009 Citrate cycle (TCA cycle, Krebs cycle)
M00011 Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce_M00011 Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce01100 Metabolic pathways
ko00640 Propanoate metabolism
sce00640 Propanoate metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
TCA-EUK-PWY-YEAST TCA cycle, aerobic respiration
PWY-5749 itaconate degradation

REACTOME Pathway Links

REACTOME Pathway ID Description
5618051 Citric acid cycle (TCA cycle)
5618023 Metabolism
5618052 Pyruvate metabolism and Citric Acid (TCA) cycle
5618053 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR005811 ATP-citrate lyase/succinyl-CoA ligase
IPR013815 ATP-grasp fold, subdomain 1
IPR013816 ATP-grasp fold, subdomain 2
IPR013650 ATP-grasp fold, succinyl-CoA synthetase-type
IPR005809 Succinyl-CoA synthetase, beta subunit
IPR017866 Succinyl-CoA synthetase, beta subunit, conserved site
IPR016102 Succinyl-CoA synthetase-like

UniProt Annotations

Entry Information

Gene Name
succinate--CoA ligase (GDP-forming) subunit beta
Protein Entry
SUCB_YEAST
UniProt ID
P53312
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity ATP + succinate + CoA = ADP + phosphate + succinyl-CoA
Catalytic Activity ATP + succinate + CoA = ADP + phosphate + succinyl-CoA. {ECO:0000269|PubMed:9874242}.
Pathway Carbohydrate metabolism; tricarboxylic acid cycle; succinate from succinyl-CoA (ligase route): step 1/1.
Similarity Belongs to the succinate/malate CoA ligase beta subunit family
Similarity Belongs to the succinate/malate CoA ligase beta subunit family. {ECO:0000305}.
Similarity Contains 1 ATP-grasp domain
Similarity Contains 1 ATP-grasp domain. {ECO:0000305}.
Subcellular Location Mitochondrion .
Subcellular Location Mitochondrion {ECO:0000250}.
Subunit Heterodimer of an alpha and a beta subunit
Subunit Heterodimer of an alpha and a beta subunit. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007492 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398366275 RefSeq NP_011760 427 succinate--CoA ligase (GDP-forming) subunit beta

Identical Sequences to LMP007492 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007492 proteins

Reference Database Accession Length Protein Name