Gene/Proteome Database (LMPD)
Proteins
Izh1p | |
---|---|
Refseq ID | NP_010780 |
Protein GI | 6320699 |
UniProt ID | Q03419 |
mRNA ID | NM_001180800 |
Length | 316 |
MSITTTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHIHP |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0001653 | ISS:SGD | F | peptide receptor activity |
GO:0006882 | IMP:SGD | P | cellular zinc ion homeostasis |
GO:0007165 | ISS:GOC | P | signal transduction |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | ADIPOR-like receptor involved in zinc metabolism either by altering membrane sterol content or by directly altering cellular zinc levels |
Function | ADIPOR-like receptor involved in zinc metabolism either by altering membrane sterol content or by directly altering cellular zinc levels. {ECO:0000269|PubMed:15060275}. |
Induction | Expression is regulated by the zinc metabolism transcription factor ZAP1 via its promoter ZRE element (zinc- responsive element). {ECO:0000269|PubMed:10884426, ECO:0000269|PubMed:15060275}. |
Similarity | Belongs to the ADIPOR family |
Similarity | Belongs to the ADIPOR family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007511 (as displayed in Record Overview)
Identical Sequences to LMP007511 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007511 proteins
Reference | Database | Accession | Length | Protein Name |
---|