LIPID MAPS

LMPD ID

LMP007513

Gene ID

851547

Species

Saccharomyces cerevisiae S288c (Yeast (S288c))

Gene Name

trans-2-enoyl-CoA reductase (NADPH) TSC13

Gene Symbol

TSC13

Synonyms

-

Chromosome

IV

EC Number

1.3.1.93

trans-2-enoyl-CoA reductase (NADPH) TSC13
Refseq ID	NP_010269
Protein GI	6320189
UniProt ID	Q99190
mRNA ID	NM_001180074
Length	310
MPITIKSRSKGLRDTEIDLSKKPTLDDVLKKISANNHNISKYRIRLTYKKESKQVPVISESFFQEEADDSMEFFIKDLGPQISWRLVFFCEYLGPVLVHSLFYYLSTIPTVVDRWHSASSDYNPFLNRVAYFLILGHYGKRLFETLFVHQFSLATMPIFNLFKNCFHYWVLSGLISFGYFGYGFPFGNAKLFKYYSYLKLDDLSTLIGLFVLSELWNFYCHIKLRLWGDYQKKHGNAKIRVPLNQGIFNLFVAPNYTFEVWSWIWFTFVFKFNLFAVLFLTVSTAQMYAWAQKKNKKYHTRRAFLIPFVF

Entrez Gene ID

851547

Gene Name

trans-2-enoyl-CoA reductase (NADPH) TSC13

Gene Symbol

TSC13

Species

Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0005789	IDA:SGD	C	endoplasmic reticulum membrane
GO:0016021	IEA:UniProtKB-KW	C	integral component of membrane
GO:0016491	IMP:SGD	F	oxidoreductase activity
GO:0016627	IEA:InterPro	F	oxidoreductase activity, acting on the CH-CH group of donors
GO:0000038	IMP:SGD	P	very long-chain fatty acid metabolic process

KEGG Pathway Links

KEGG Pathway ID	Description
sce01110	Biosynthesis of secondary metabolites
ko01040	Biosynthesis of unsaturated fatty acids
sce01040	Biosynthesis of unsaturated fatty acids
M00415	Fatty acid biosynthesis, elongation, endoplasmic reticulum
sce_M00415	Fatty acid biosynthesis, elongation, endoplasmic reticulum
ko00062	Fatty acid elongation
sce00062	Fatty acid elongation
ko01212	Fatty acid metabolism
sce01212	Fatty acid metabolism
sce01100	Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID	Description
PWY-7036	very long chain fatty acid biosynthesis II

REACTOME Pathway Links

REACTOME Pathway ID	Description
5618090	Fatty acid, triacylglycerol, and ketone body metabolism
5618114	Fatty Acyl-CoA Biosynthesis
5618023	Metabolism
5618091	Metabolism of lipids and lipoproteins
5618123	Synthesis of very long-chain fatty acyl-CoAs
5618115	Triglyceride Biosynthesis

InterPro Annotations

Accession	Description
IPR001104	3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

Entry Information

Gene Name

trans-2-enoyl-CoA reductase (NADPH) TSC13

Protein Entry

TSC13_YEAST

UniProt ID

Q99190

Species

Yeast (S288c)

Comments

Comment Type	Description
Catalytic Activity	A very-long-chain acyl-CoA + NADP(+) = a very- long-chain trans-2,3-dehydroacyl-CoA + NADPH.
Function	Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long chain fatty acids (VLCFA) from palmitate. Catalyzes the last step in each elongation cycle that lengthens palmitate by two carbon units. VLCFAs serve as precursors for ceramide and sphingolipids. Required for normal biogenesis of piecemeal microautophagy of the nucleus (PMN) bleps and vesicles during nutrient stress
Function	Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long chain fatty acids (VLCFA) from palmitate. Catalyzes the last step in each elongation cycle that lengthens palmitate by two carbon units. VLCFAs serve as precursors for ceramide and sphingolipids. Required for normal biogenesis of piecemeal microautophagy of the nucleus (PMN) bleps and vesicles during nutrient stress. {ECO:0000269\|PubMed:11113186, ECO:0000269\|PubMed:15958487}.
Miscellaneous	Present with 23600 molecules/cell in log phase SD medium
Miscellaneous	Present with 23600 molecules/cell in log phase SD medium. {ECO:0000269\|PubMed:14562106}.
Similarity	Belongs to the steroid 5-alpha reductase family
Similarity	Belongs to the steroid 5-alpha reductase family. {ECO:0000305}.
Subcellular Location	Endoplasmic reticulum membrane {ECO:0000269\|PubMed:11113186, ECO:0000269\|PubMed:14562095, ECO:0000269\|PubMed:15958487}; Multi-pass membrane protein {ECO:0000269\|PubMed:11113186, ECO:0000269\|PubMed:14562095, ECO:0000269\|PubMed:15958487}. Note=Accumulates at nucleus-vacuole (NV) junctions. Sequestred to NV junctions by NVJ1. Accumulates in nuclear PMN bleps and vesicles during stationary phase and nitrogen starvation.
Subunit	Interacts with the fatty acid elongation system components ELO2 and ELO3. Interacts with NVJ1
Subunit	Interacts with the fatty acid elongation system components ELO2 and ELO3. Interacts with NVJ1. {ECO:0000269\|PubMed:11113186, ECO:0000269\|PubMed:15958487}.