Gene/Proteome Database (LMPD)
Proteins
Atf1p | |
---|---|
Refseq ID | NP_015022 |
Protein GI | 398366429 |
UniProt ID | P40353 |
mRNA ID | NM_001183797 |
Length | 525 |
RefSeq Status | PROVISIONAL |
MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEKWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQAIKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQAFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005811 | IDA:SGD | C | lipid particle |
GO:0016020 | IEA:UniProtKB-KW | C | membrane |
GO:0004026 | IDA:SGD | F | alcohol O-acetyltransferase activity |
GO:1900619 | IMP:SGD | P | acetate ester metabolic process |
GO:0006066 | IEA:InterPro | P | alcohol metabolic process |
GO:0006113 | IMP:SGD | P | fermentation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR010828 | Alcohol acetyltransferase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | pH dependence: Optimum pH is 8.; Temperature dependence: Optimum temperature is 25 degrees Celsius.; |
Catalytic Activity | Acetyl-CoA + an alcohol = CoA + an acetyl ester. |
Enzyme Regulation | Found to be inhibited by cadmium, copper, zinc and mercurium divalent cations and sulfhydryl reagents. Inhibited by the addition of unsaturated fatty acids to the culture. |
Function | Catalyzes the esterification of isoamyl alcohol and various other alcohols by acetyl-CoA. |
Induction | Repressed under aerobic conditions. |
Miscellaneous | Present with 1990 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | To yeast ATF2. {ECO:0000305}. |
Subcellular Location | Membrane; Peripheral membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007516 (as displayed in Record Overview)
Identical Sequences to LMP007516 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:398366429 | GenBank | EGA84784.1 | 525 | Atf1p [Saccharomyces cerevisiae VL3] |
GI:398366429 | GenBank | EIW07804.1 | 525 | Atf1p [Saccharomyces cerevisiae CEN.PK113-7D] |
GI:398366429 | GenBank | EWG83432.1 | 525 | Atf1p [Saccharomyces cerevisiae R008] |
GI:398366429 | GenBank | EWG93304.1 | 525 | Atf1p [Saccharomyces cerevisiae R103] |
GI:398366429 | GenBank | EWH16148.1 | 525 | Atf1p [Saccharomyces cerevisiae P283] |
GI:398366429 | gnl | McCuskerlabDuke | 525 | Atf1p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP007516 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:398366429 | DBBJ | BAA09752.1 | 525 | alcohol acetyltransferase [Saccharomyces pastorianus] |
GI:398366429 | EMBL | CAY38216.1 | 525 | unnamed protein product [Saccharomyces pastorianus] |
GI:398366429 | GenBank | AAB13333.1 | 525 | Sequence 17 from patent US 5521088 |
GI:398366429 | pat | US | 525 | Sequence 17 from patent US 5686284 |
GI:398366429 | pat | US | 525 | Sequence 17 from patent US 5728412 |
GI:398366429 | PIR | - | 525 | alcohol O-acetyltransferase (EC 2.3.1.84) ATF1 - yeast (Saccharomyces cerevisiae) (strain carlsbergensis) [Saccharomyces cerevisiae] |