Gene/Proteome Database (LMPD)

LMPD ID
LMP007528
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
glutathione peroxidase GPX2
Gene Symbol
Synonyms
AMI1
Alternate Names
glutathione peroxidase GPX2
Chromosome
II
EC Number
1.11.1.9

Proteins

glutathione peroxidase GPX2
Refseq ID NP_009803
Protein GI 398365707
UniProt ID P38143
mRNA ID NM_001178592
Length 162
RefSeq Status PROVISIONAL
MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK

Gene Information

Entrez Gene ID
Gene Name
glutathione peroxidase GPX2
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:SGD C cytoplasm
GO:0031314 IDA:SGD C extrinsic component of mitochondrial inner membrane
GO:0031315 IDA:SGD C extrinsic component of mitochondrial outer membrane
GO:0004602 IDA:SGD F glutathione peroxidase activity
GO:0047066 IDA:SGD F phospholipid-hydroperoxide glutathione peroxidase activity
GO:0034599 IMP:SGD P cellular response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
sce00590 Arachidonic acid metabolism
sce00480 Glutathione metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-4081 glutathione redox reactions I

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase GPX2
Protein Entry
GPX2_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function May constitute a glutathione peroxidase-like protective system against oxidative stresses. {ECO:0000250}.
Interaction P20449:DBP5; NbExp=1; IntAct=EBI-7863, EBI-5617; P36156:ECM4; NbExp=1; IntAct=EBI-7863, EBI-2042717; Q07651:FMP45; NbExp=1; IntAct=EBI-7863, EBI-2051056; P19807:HNM1; NbExp=1; IntAct=EBI-7863, EBI-8409; P32466:HXT3; NbExp=1; IntAct=EBI-7863, EBI-8770; P39004:HXT7; NbExp=1; IntAct=EBI-7863, EBI-8790; P50276:MUP1; NbExp=1; IntAct=EBI-7863, EBI-11624; Q02785:PDR12; NbExp=1; IntAct=EBI-7863, EBI-13065; P40975:PMP2; NbExp=1; IntAct=EBI-7863, EBI-2043041; P87284:PMP3; NbExp=1; IntAct=EBI-7863, EBI-13555; P38234:RFS1; NbExp=1; IntAct=EBI-7863, EBI-21445; P09938:RNR2; NbExp=1; IntAct=EBI-7863, EBI-15240; P35735:SFK1; NbExp=1; IntAct=EBI-7863, EBI-26678; Q06451:TPO3; NbExp=1; IntAct=EBI-7863, EBI-34275; Q3E756:YBL029C-A; NbExp=1; IntAct=EBI-7863, EBI-2044812; P38845:YHR146W; NbExp=1; IntAct=EBI-7863, EBI-24770;
Miscellaneous Present with 2010 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the glutathione peroxidase family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007528 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398365707 RefSeq NP_009803 162 glutathione peroxidase GPX2

Identical Sequences to LMP007528 proteins

Reference Database Accession Length Protein Name
GI:398365707 GenBank AGD32286.1 162 Sequence 29742 from patent US 8343764
GI:398365707 GenBank EWG87808.1 162 Gpx2p [Saccharomyces cerevisiae R008]
GI:398365707 GenBank EWG92571.1 162 Gpx2p [Saccharomyces cerevisiae P301]
GI:398365707 GenBank EWG97436.1 162 Gpx2p [Saccharomyces cerevisiae R103]
GI:398365707 GenBank EWH19617.1 162 Gpx2p [Saccharomyces cerevisiae P283]
GI:398365707 gnl McCuskerlabDuke 162 Gpx2p [Saccharomyces cerevisiae YJM993]

Related Sequences to LMP007528 proteins

Reference Database Accession Length Protein Name
GI:398365707 DBBJ GAA21790.1 162 K7_Gpx2p [Saccharomyces cerevisiae Kyokai no. 7]
GI:398365707 GenBank EGA63225.1 162 Gpx2p [Saccharomyces cerevisiae FostersO]
GI:398365707 GenBank EGA83847.1 162 Gpx2p [Saccharomyces cerevisiae Lalvin QA23]
GI:398365707 GenBank EHN03522.1 175 Gpx2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:398365707 GenBank EJS44691.1 162 gpx2p [Saccharomyces arboricola H-6]
GI:398365707 GenBank EJT44687.1 162 GPX2-like protein [Saccharomyces kudriavzevii IFO 1802]