Gene/Proteome Database (LMPD)
Proteins
Fld1p | |
---|---|
Refseq ID | NP_013508 |
Protein GI | 398366135 |
UniProt ID | Q06058 |
mRNA ID | NM_001182292 |
Length | 285 |
MKINVSRPLQFLQWSSYIVVAFLIQLLIILPLSILIYHDFYLRLLPADSSNVVPLNTFNILNGVQFGTKFFQSIKSIPVGTDLPQTIDNGLSQLIPMRDNMEYKLDLNLQLYCQSKTDHLNLDNLLIDVYRGPGPLLGAPGGSNSKDEKIFHTSRPIVCLALTDSMSPQEIEQLGPSRLDVYDEEWLNTIRIEDKISLESSYETISVFLKTEIAQRNLIIHPESGIKFRMNFEQGLRNLMLRKRFLSYIIGISIFHCIICVLFFITGCTAFIFVRKGQEKSKKHS |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0032541 | IDA:SGD | C | cortical endoplasmic reticulum |
GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
GO:0016021 | ISM:SGD | C | integral component of membrane |
GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
GO:0034389 | IMP:SGD | P | lipid particle organization |
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Involved in lipid metabolism and lipid droplet morphology, number, and size. {ECO:0000269|PubMed:18093937, ECO:0000269|PubMed:18250201}. |
Induction | By calcium shortage |
Induction | By calcium shortage. {ECO:0000269|PubMed:12161108}. |
Interaction | P10664:RPL4A; NbExp=1; IntAct=EBI-35851, EBI-15390; |
Miscellaneous | Present with 846 molecules/cell in log phase SD medium |
Miscellaneous | Present with 846 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the seipin family |
Similarity | Belongs to the seipin family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane ; Multi- pass membrane protein {ECO:0000269|PubMed:18093937, ECO:0000269|PubMed:18250201}. Note=Concentrates at endoplasmic reticulum lipid droplet junctions. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:18093937, ECO:0000269|PubMed:18250201}; Multi- pass membrane protein {ECO:0000269|PubMed:18093937, ECO:0000269|PubMed:18250201}. Note=Concentrates at endoplasmic reticulum lipid droplet junctions. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007530 (as displayed in Record Overview)
Identical Sequences to LMP007530 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007530 proteins
Reference | Database | Accession | Length | Protein Name |
---|