Gene/Proteome Database (LMPD)

LMPD ID
LMP007573
Gene ID
945645
Species
Escherichia coli K-12 (E. coli)
Gene Name
3-oxoacyl-[acyl-carrier-protein] reductase
Gene Symbol
fabG
Synonyms
ECK1079; JW1079
Summary
FabG converts ethyl 4-chloroacetoacetate (ECAA) to ethyl ( S)-4-chloro-3-hydroxybutanoate (ECHB) in vitro. [More information is available at EcoGene: EG11318]. Cotranscribed with acpP. [More information is available at EcoCyc: EG11318].
Orthologs
View orthologs and multiple alignments for fabG

Proteins

3-oxoacyl-[acyl-carrier-protein] reductase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415611
Protein GI 16129056
UniProt ID P0AEK2
Length 244
RefSeq Status REVIEWED
MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV

Gene Information

Entrez Gene ID
945645
Gene Name
3-oxoacyl-[acyl-carrier-protein] reductase
Gene Symbol
fabG
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004316 IMP:UniProtKB F 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
GO:0051287 IEA:InterPro F NAD binding
GO:0050661 IDA:UniProtKB F NADP binding
GO:0042802 IDA:EcoCyc F identical protein binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0009102 IMP:EcoCyc P biotin biosynthetic process
GO:0006633 IMP:EcoCyc P fatty acid biosynthetic process
GO:0030497 IMP:UniProtKB P fatty acid elongation
GO:0008610 IMP:EcoCyc P lipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco01040 Biosynthesis of unsaturated fatty acids
ko01040 Biosynthesis of unsaturated fatty acids
eco00780 Biotin metabolism
ko00780 Biotin metabolism
eco00061 Fatty acid biosynthesis
ko00061 Fatty acid biosynthesis
M00083 Fatty acid biosynthesis, elongation
eco_M00083 Fatty acid biosynthesis, elongation
eco01212 Fatty acid metabolism
ko01212 Fatty acid metabolism
eco01100 Metabolic pathways
M00572 Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
eco_M00572 Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6519 8-amino-7-oxononanoate biosynthesis I
PWY-6519 8-amino-7-oxononanoate biosynthesis I
BIOTIN-BIOSYNTHESIS-PWY biotin biosynthesis I
BIOTIN-BIOSYNTHESIS-PWY biotin biosynthesis I
PWY0-862 cis-dodecenoyl biosynthesis
PWY0-862 cis-dodecenoyl biosynthesis
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
PWY-5971 palmitate biosynthesis II (bacteria and plants)
PWY-5971 palmitate biosynthesis II (bacteria and plants)
PWY-6282 palmitoleate biosynthesis I
PWY-6282 palmitoleate biosynthesis I
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY-6285 superpathway of fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)

Domain Information

InterPro Annotations

Accession Description
IPR011284 3-oxoacyl-(acyl-carrier-protein) reductase
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
3-oxoacyl-[acyl-carrier-protein] reductase
Protein Entry
FABG_ECOLI
UniProt ID
P0AEK2
Species
E. coli

Comments

Comment Type Description
Biophysicochemical Properties pH dependence: Optimum pH is between 6.0 and 7.0. {ECO:0000269|PubMed:4381013};
Catalytic Activity (3R)-3-hydroxyacyl-[acyl-carrier-protein] + NADP(+) = 3-oxoacyl-[acyl-carrier-protein] + NADPH. {ECO:0000269|PubMed:8631920}.
Enzyme Regulation Inhibited by cinnamic acid derivatives. {ECO:0000269|PubMed:18977209}.
Function Catalyzes the NADPH-dependent reduction of beta- ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis. {ECO:0000269|PubMed:14996818, ECO:0000269|PubMed:8631920}.
Miscellaneous Calcium ions stabilize the structure, and may inhibit FabG activity by obstructing access to the active site.
Pathway Lipid metabolism; fatty acid biosynthesis.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}.
Subunit Homotetramer. {ECO:0000269|PubMed:11669613, ECO:0000269|PubMed:15016358}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007573 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129056 RefSeq NP_415611 244 3-oxoacyl-[acyl-carrier-protein] reductase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007573 proteins

Reference Database Accession Length Protein Name
GI:16129056 GenBank KHJ05628.1 244 3-ketoacyl-ACP reductase [Escherichia coli]
GI:16129056 GenBank KHJ10639.1 244 3-ketoacyl-ACP reductase [Escherichia coli]
GI:16129056 GenBank KHJ17520.1 244 3-ketoacyl-ACP reductase [Escherichia coli]
GI:16129056 GenBank KHJ22768.1 244 3-ketoacyl-ACP reductase [Escherichia coli]
GI:16129056 GenBank KHJ27493.1 244 3-ketoacyl-ACP reductase [Escherichia coli]
GI:16129056 gnl IGS 244 3-oxoacyl-[acyl-carrier-protein] reductase [Escherichia coli ER2796]

Related Sequences to LMP007573 proteins

Reference Database Accession Length Protein Name
GI:16129056 GenBank EMW23334.1 244 3-oxoacyl-[acyl-carrier-protein] reductase [Escherichia coli 2845650]
GI:16129056 GenBank END12660.1 262 3-oxoacyl-[acyl-carrier-protein] reductase [Escherichia coli P0302308.3]
GI:16129056 GenBank ETE12674.1 244 3-ketoacyl-ACP reductase [Escherichia coli LAU-EC8]
GI:16129056 GenBank ETE39023.1 244 3-ketoacyl-ACP reductase [Escherichia coli LAU-EC9]
GI:16129056 RefSeq WP_001718014.1 244 3-oxoacyl-[acyl-carrier-protein] reductase [Escherichia coli]
GI:16129056 RefSeq WP_022645528.1 244 3-oxoacyl-[acyl-carrier-protein] reductase [Escherichia coli]