Gene/Proteome Database (LMPD)
LMPD ID
LMP007577
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase
Gene Symbol
Synonyms
ECK2224; JW2226; pufX; yfaB
Summary
The ubiG gene product is an O-methyltransferase that catalyzes both O-methylation reactions in the biosynthesis of ubiquinone. [More information is available at EcoCyc: EG11143].
Orthologs
Proteins
| bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_416735 |
| Protein GI | 16130167 |
| UniProt ID | P17993 |
| Length | 240 |
| RefSeq Status | REVIEWED |
| MNAEKSPVNHNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGKSWLMAVVGAEYILRMVPKGTHDVKKFIKPAELLGWVDQTSLKERHITGLHYNPITNTFKLGPGVDVNYMLHTQNK | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0043431 | IDA:EcoCyc | F | 2-octaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinone methyltransferase activity |
| GO:0008425 | IEA:InterPro | F | 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity |
| GO:0008689 | IEA:UniProtKB-EC | F | 3-demethylubiquinone-9 3-O-methyltransferase activity |
| GO:0006744 | IMP:EcoCyc | P | ubiquinone biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco01110 | Biosynthesis of secondary metabolites |
| eco01100 | Metabolic pathways |
| eco00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
| ko00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
| M00117 | Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone |
| eco_M00117 | Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| ALL-CHORISMATE-PWY | superpathway of chorismate metabolism |
| ALL-CHORISMATE-PWY | superpathway of chorismate metabolism |
| UBISYN-PWY | superpathway of ubiquinol-8 biosynthesis (prokaryotic) |
| UBISYN-PWY | superpathway of ubiquinol-8 biosynthesis (prokaryotic) |
| PWY-6708 | ubiquinol-8 biosynthesis (prokaryotic) |
| UBISYN-PWY | ubiquinol-8 biosynthesis (prokaryotic) |
| PWY-6708 | ubiquinol-8 biosynthesis (prokaryotic) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase
Protein Entry
UBIG_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | S-adenosyl-L-methionine + 3- demethylubiquinone-n = S-adenosyl-L-homocysteine + ubiquinone-n. {ECO:0000255|HAMAP-Rule:MF_00472, ECO:0000269|PubMed:10419476}. |
| Catalytic Activity | S-adenosyl-L-methionine + 3-(all-trans- polyprenyl)benzene-1,2-diol = S-adenosyl-L-homocysteine + 2- methoxy-6-(all-trans-polyprenyl)phenol. {ECO:0000255|HAMAP- Rule:MF_00472, ECO:0000269|PubMed:10419476}. |
| Function | Non-specific O-methyltransferase that catalyzes the 2 O- methylation steps in the ubiquinone biosynthetic pathway. {ECO:0000255|HAMAP-Rule:MF_00472, ECO:0000269|PubMed:10419476}. |
| Interaction | P61175:rplV; NbExp=2; IntAct=EBI-559367, EBI-542255; |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. {ECO:0000255|HAMAP-Rule:MF_00472}. |
| Similarity | Belongs to the methyltransferase superfamily. UbiG/COQ3 family. {ECO:0000255|HAMAP-Rule:MF_00472}. |
| Subunit | Homodimer. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007577 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16130167 | RefSeq | NP_416735 | 240 | bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007577 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16130167 | GenBank | KHI19775.1 | 240 | 3-demethylubiquinone-9 3-methyltransferase [Escherichia coli] |
| GI:16130167 | GenBank | KHI34368.1 | 240 | 3-demethylubiquinone-9 3-methyltransferase [Escherichia coli] |
| GI:16130167 | GenBank | KHI44422.1 | 240 | 3-demethylubiquinone-9 3-methyltransferase [Escherichia coli] |
| GI:16130167 | GenBank | KHI60004.1 | 240 | 3-demethylubiquinone-9 3-methyltransferase [Escherichia coli] |
| GI:16130167 | GenBank | KHJ14713.1 | 240 | 3-demethylubiquinone-9 3-methyltransferase [Escherichia coli] |
| GI:16130167 | gnl | IGS | 240 | bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase [Escherichia coli ER2796] |
Related Sequences to LMP007577 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16130167 | GenBank | EFJ64204.1 | 256 | 3-demethylubiquinone-9 3-O-methyltransferase [Escherichia coli MS 175-1] |
| GI:16130167 | GenBank | EGI11879.1 | 256 | 3-demethylubiquinone-9 3-O-methyltransferase [Escherichia coli H736] |
| GI:16130167 | GenBank | EGI40411.1 | 256 | 3-demethylubiquinone-9 3-O-methyltransferase [Escherichia coli TA280] |
| GI:16130167 | GenBank | ESU79030.1 | 256 | 3-demethylubiquinone 3-methyltransferase [Shigella dysenteriae WRSd3] |
| GI:16130167 | GenBank | ESU85125.1 | 256 | 3-demethylubiquinone 3-methyltransferase [Shigella dysenteriae WRSd5] |
| GI:16130167 | gnl | igergo | 256 | 3-demethylubiquinone 3-methyltransferase [Shigella dysenteriae 1617] |