Gene/Proteome Database (LMPD)

LMPD ID
LMP007588
Gene ID
947954
Species
Escherichia coli K-12 (E. coli)
Gene Name
ABC transporter maintaining OM lipid asymmetry, cytoplasmic STAS component
Gene Symbol
mlaB
Synonyms
ECK3180; JW5535; yrbB
Summary
The STAS domain is found in sulfate transporters and anti-sigmas and may bind NTPs. [More information is available at EcoGene: EG12797].
Orthologs
View orthologs and multiple alignments for mlaB

Proteins

ABC transporter maintaining OM lipid asymmetry, cytoplasmic STAS component [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417658
Protein GI 90111556
UniProt ID P64602
Length 97
RefSeq Status REVIEWED
MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR

Gene Information

Entrez Gene ID
947954
Gene Name
ABC transporter maintaining OM lipid asymmetry, cytoplasmic STAS component
Gene Symbol
mlaB
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0005548 IMP:EcoCyc F phospholipid transporter activity
GO:0006974 IMP:EcoCyc P cellular response to DNA damage stimulus
GO:0015914 IMP:GOC P phospholipid transport
GO:0046677 IMP:EcoCyc P response to antibiotic

KEGG Pathway Links

KEGG Pathway ID Description
eco02010 ABC transporters
ko02010 ABC transporters
M00210 Phospholipid transport system
eco_M00210 Phospholipid transport system

Domain Information

InterPro Annotations

Accession Description
IPR002645 STAS_dom

UniProt Annotations

Entry Information

Gene Name
ABC transporter maintaining OM lipid asymmetry, cytoplasmic STAS component
Protein Entry
MLAB_ECOLI
UniProt ID
P64602
Species
E. coli

Comments

Comment Type Description
Disruption Phenotype Mutation confers sensitivity to SDS-EDTA and leads to accumulation of phospholipid in the outer leaflet of the outer membrane. {ECO:0000269|PubMed:19383799}.
Function Part of the ABC transporter complex MlaFEDB that actively prevents phospholipid accumulation at the cell surface. Probably maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. {ECO:0000269|PubMed:19383799}.
Sequence Caution Sequence=AAA57992.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Similarity Contains 1 STAS domain. {ECO:0000255|PROSITE- ProRule:PRU00198}.
Subcellular Location Cytoplasm {ECO:0000305|PubMed:19383799}.
Subunit The complex is composed of two ATP-binding proteins (MlaF), two transmembrane proteins (MlaE), two cytoplasmic solute- binding proteins (MlaB) and a periplamic solute-binding protein (MlaD). {ECO:0000305|PubMed:19383799}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007588 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90111556 RefSeq NP_417658 97 ABC transporter maintaining OM lipid asymmetry, cytoplasmic STAS component [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007588 proteins

Reference Database Accession Length Protein Name
GI:90111556 GenBank KHJ00159.1 97 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:90111556 GenBank KHJ01632.1 97 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:90111556 GenBank KHJ07261.1 97 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:90111556 GenBank KHJ13775.1 97 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:90111556 GenBank KHJ25764.1 97 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:90111556 gnl IGS 97 ABC transporter maintaining OM lipid asymmetry, cytoplasmic STAS component [Escherichia coli ER2796]

Related Sequences to LMP007588 proteins

Reference Database Accession Length Protein Name
GI:90111556 GenBank AAA57992.1 129 ORF_f129 [Escherichia coli str. K-12 substr. MG1655]
GI:90111556 GenBank AAP18511.1 129 hypothetical protein S3449 [Shigella flexneri 2a str. 2457T]
GI:90111556 GenBank EID63515.1 129 hypothetical protein SF5M90T_3146 [Shigella flexneri 5a str. M90T]
GI:90111556 RefSeq NP_838700.1 129 hypothetical protein S3449 [Shigella flexneri 2a str. 2457T]
GI:90111556 RefSeq YP_312147.1 129 hypothetical protein SSON_3339 [Shigella sonnei Ss046]
GI:90111556 RefSeq YP_005728851.1 129 putative NTP binding protein (contains STAS domain) [Shigella flexneri 2002017]