Gene/Proteome Database (LMPD)

LMPD ID
LMP007605
Gene ID
947903
Species
Escherichia coli K-12 (E. coli)
Gene Name
isoprenoid biosynthesis protein with amidotransferase-like domain
Gene Symbol
elbB
Synonyms
ECK3198; JW3176; elb2; yhbL; yzzB
Summary
Variously called C56 peptidase family, PfpI/HchA peptidase/chaperone family, DJ-1/PARK7 superfamily. [More information is available at EcoGene: EG11383]. The ElbB protein cross-reacts with an antibody prepared against a peptide of the 2.2 region of sigma 70 and sigma 32 and was therefore originally named sigma cross-reacting protein 27A (SCRP-27A) . elbB was identified in a mutant screen designed to identify genes involved in the biosynthesis of isopentenyl diphosphate, a precursor of isoprenoids . [More information is available at EcoCyc: EG11383].
Orthologs
View orthologs and multiple alignments for elbB

Proteins

isoprenoid biosynthesis protein with amidotransferase-like domain [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417676
Protein GI 90111557
UniProt ID P0ABU5
Length 217
RefSeq Status REVIEWED
MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMTETRNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMCIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVVDEDNKIVTTPAYMLAQNIAEAASGIDKLVSRVLVLAE

Gene Information

Entrez Gene ID
947903
Gene Name
isoprenoid biosynthesis protein with amidotransferase-like domain
Gene Symbol
elbB
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008299 IMP:EcoliWiki P isoprenoid biosynthetic process
GO:0045828 IMP:EcoliWiki P positive regulation of isoprenoid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR029062 Class I glutamine amidotransferase-like
IPR026041 Elb2
IPR002818 ThiJ/PfpI

UniProt Annotations

Entry Information

Gene Name
isoprenoid biosynthesis protein with amidotransferase-like domain
Protein Entry
ELBB_ECOLI
UniProt ID
P0ABU5
Species
E. coli

Comments

Comment Type Description
Function May be involved in the early steps of isoprenoid biosynthesis.
Interaction P0A8V2:rpoB; NbExp=1; IntAct=EBI-1132026, EBI-544996;
Sequence Caution Sequence=AAA58011.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Similarity Belongs to the ES1 family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007605 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90111557 RefSeq NP_417676 217 isoprenoid biosynthesis protein with amidotransferase-like domain [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007605 proteins

Reference Database Accession Length Protein Name
GI:90111557 GenBank KHI13733.1 217 isoprenoid biosynthesis protein [Escherichia coli]
GI:90111557 GenBank KHI13912.1 217 isoprenoid biosynthesis protein [Escherichia coli]
GI:90111557 GenBank KHI24362.1 217 isoprenoid biosynthesis protein [Escherichia coli]
GI:90111557 GenBank KHI36719.1 217 isoprenoid biosynthesis protein [Escherichia coli]
GI:90111557 GenBank KHI56854.1 217 isoprenoid biosynthesis protein [Escherichia coli]
GI:90111557 GenBank KHI99135.1 217 isoprenoid biosynthesis protein [Escherichia coli]

Related Sequences to LMP007605 proteins

Reference Database Accession Length Protein Name
GI:90111557 GenBank AAA58011.1 220 sigma cross-reacting protein 27A [Escherichia coli str. K-12 substr. MG1655]
GI:90111557 GenBank ESA65856.1 220 enhancing lycopene biosynthesis protein 2 [Escherichia coli 110957]
GI:90111557 GenBank ESA93220.1 220 enhancing lycopene biosynthesis protein 2 [Escherichia coli 907713]
GI:90111557 GenBank ESA94718.1 220 enhancing lycopene biosynthesis protein 2 [Escherichia coli 909945-2]
GI:90111557 gnl zhongguo 220 Sigma cross-reacting protein 27A [Escherichia coli P12b]
GI:90111557 RefSeq YP_006170322.1 220 Sigma cross-reacting protein 27A [Escherichia coli P12b]