Gene/Proteome Database (LMPD)
LMPD ID
LMP007607
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
lipopolysaccharide biosynthesis protein
Gene Symbol
Synonyms
ECK2026; JW2017; yefI
Summary
None
Orthologs
Proteins
| lipopolysaccharide biosynthesis protein [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_416536 |
| Protein GI | 16129972 |
| UniProt ID | P37751 |
| Length | 372 |
| RefSeq Status | REVIEWED |
| MGKSIVVVSAVNFTTGGPFTILKKFLAATNNKENVSFIALVHSAKELKESYPWVKFIEFPEVKGSWLKRLHFEYVVCKKLSKELNATHWICLHDITANVVTKKRYVYCHNPAPFYKGILFREILMEPSFFLFKMLYGLIYKINIKKNTAVFVQQFWMKEKFIKKYSINNIIVSRPEIKLSDKSQLTDDDSQFKNNPSELTIFYPAVPRVFKNYELIISAARKLKEQSNIKFLLTISGTENAYAKYIISLAEGLDNVHFLGYLDKEKIDHCYNISDIVCFPSRLETWGLPLSEAKERGKWVLASDFPFTRETLGSYEKKAFFDSNNDDMLVKLIIDFKKGNLKKDISDANFIYRNENVLVGFDELVNFITEEH | |
Gene Information
Entrez Gene ID
Gene Name
lipopolysaccharide biosynthesis protein
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0009103 | IEA:UniProtKB-UniPathway | P | lipopolysaccharide biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001296 | Glycosyl transferase, family 1 |
UniProt Annotations
Entry Information
Gene Name
lipopolysaccharide biosynthesis protein
Protein Entry
WBBK_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Function | May be a glycosyltransferase involved in the transfer of UDP-GalF and UDP-glucose. |
| Pathway | Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis. |
| Subcellular Location | Cell inner membrane {ECO:0000305}; Peripheral membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007607 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16129972 | RefSeq | NP_416536 | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007607 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16129972 | EMBL | CEE08341.1 | 372 | glycosyl transferases group 1 family protein [Escherichia coli] |
| GI:16129972 | EMBL | CDY59317.1 | 372 | predicted lipopolysaccharide biosynthesis protein [Escherichia coli] |
| GI:16129972 | EMBL | CDZ20853.1 | 372 | predicted lipopolysaccharide biosynthesis protein [Escherichia coli] |
| GI:16129972 | GenBank | KGL67754.1 | 372 | putative glycosyltransferase [Escherichia coli NCTC 50110] |
| GI:16129972 | gnl | PRJNA257976 | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli BW25113] |
| GI:16129972 | gnl | IGS | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli ER2796] |
Related Sequences to LMP007607 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16129972 | GenBank | EQS64949.1 | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli HVH 158 (4-3224287)] |
| GI:16129972 | GenBank | EQT24336.1 | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli HVH 175 (4-3405184)] |
| GI:16129972 | GenBank | EQT45203.1 | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli HVH 184 (4-3343286)] |
| GI:16129972 | GenBank | ERB06297.1 | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli KOEGE 10 (25a)] |
| GI:16129972 | gnl | PRJNA215084 | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli C321.deltaA] |
| GI:16129972 | RefSeq | WP_021524299.1 | 372 | lipopolysaccharide biosynthesis protein [Escherichia coli] |