Gene/Proteome Database (LMPD)

LMPD ID
LMP007615
Gene ID
945812
Species
Escherichia coli K-12 (E. coli)
Gene Name
long-chain acyl-CoA thioesterase III
Gene Symbol
fadM
Synonyms
ECK0437; JW0433; tesC; ybaW
Summary
3,5-tetradecadienoyl-CoA is the preferred substrate for thioesterase III, which is induced by fatty acids, suggesting a role in beta-oxidation of fatty acids (Nie, 2008). [More information is available at EcoGene: EG13251]. Thioesterase III is a long-chain acyl-CoA thioesterase that is involved in the -oxidation of oleic acid. [More information is available at EcoCyc: G6244].
Orthologs
View orthologs and multiple alignments for fadM

Proteins

long-chain acyl-CoA thioesterase III [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_414977
Protein GI 16128428
UniProt ID P77712
Length 132
RefSeq Status REVIEWED
MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMTAHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALITFVCIDLKTQKALALEGELREKLEQMVK

Gene Information

Entrez Gene ID
945812
Gene Name
long-chain acyl-CoA thioesterase III
Gene Symbol
fadM
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0047617 IDA:EcoCyc F acyl-CoA hydrolase activity
GO:0006635 IEP:EcoCyc P fatty acid beta-oxidation

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY0-1337 oleate beta-oxidation
PWY0-1337 oleate beta-oxidation

Domain Information

InterPro Annotations

Accession Description
IPR029069 HotDog domain
IPR006683 Thioesterase superfamily
IPR006684 YbgC/YbaW

UniProt Annotations

Entry Information

Gene Name
long-chain acyl-CoA thioesterase III
Protein Entry
FADM_ECOLI
UniProt ID
P77712
Species
E. coli

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=3.0 uM for 3,5-cis-tetradecadienoyl-CoA {ECO:0000269|PubMed:18576672}; KM=10.8 uM for 3,5-cis-dodecadienoyl-CoA {ECO:0000269|PubMed:18576672}; KM=5.8 uM for 3-hydroxytetradecanoyl-CoA {ECO:0000269|PubMed:18576672}; KM=6.0 uM for palmitoyl-CoA {ECO:0000269|PubMed:18576672}; KM=6.3 uM for myristoyl-CoA {ECO:0000269|PubMed:18576672}; KM=13.0 uM for lauroyl-CoA {ECO:0000269|PubMed:18576672}; Vmax=101.3 umol/min/mg enzyme with 3,5-cis-tetradecadienoyl-CoA as substrate {ECO:0000269|PubMed:18576672}; Vmax=92.3 umol/min/mg enzyme with 3,5-cis-dodecadienoyl-CoA as substrate {ECO:0000269|PubMed:18576672}; Vmax=45.5 umol/min/mg enzyme with 3-hydroxytetradecanoyl-CoA as substrate {ECO:0000269|PubMed:18576672}; Vmax=43.5 umol/min/mg enzyme with palmitoyl-CoA as substrate {ECO:0000269|PubMed:18576672}; Vmax=26.4 umol/min/mg enzyme with myristoyl-CoA as substrate {ECO:0000269|PubMed:18576672}; Vmax=6.9 umol/min/mg enzyme with lauroyl-CoA as substrate {ECO:0000269|PubMed:18576672};
Function Long-chain acyl-CoA thioesterase with a preference for 3,5-tetradecadienoyl-CoA. Could be involved in beta-oxidation of fatty acids. {ECO:0000269|PubMed:18576672}.
Induction Up-regulated by growth on oleic acid. Repressed by FadR and by the cyclic AMP receptor protein-cAMP (CRP-cAMP) complex. {ECO:0000269|PubMed:18576672, ECO:0000269|PubMed:19684132}.
Similarity Belongs to the 4-hydroxybenzoyl-CoA thioesterase family. {ECO:0000305}.
Subunit Homotetramer. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007615 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16128428 RefSeq NP_414977 132 long-chain acyl-CoA thioesterase III [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007615 proteins

Reference Database Accession Length Protein Name
GI:16128428 GenBank KHI96380.1 132 thioesterase [Escherichia coli]
GI:16128428 GenBank KHJ06433.1 132 thioesterase [Escherichia coli]
GI:16128428 GenBank KHJ15734.1 132 thioesterase [Escherichia coli]
GI:16128428 GenBank KHJ22535.1 132 thioesterase [Escherichia coli]
GI:16128428 GenBank KHJ27616.1 132 thioesterase [Escherichia coli]
GI:16128428 gnl IGS 132 long-chain acyl-CoA thioesterase III [Escherichia coli ER2796]

Related Sequences to LMP007615 proteins

Reference Database Accession Length Protein Name
GI:16128428 GenBank EQP43467.1 132 long-chain acyl-CoA thioesterase tesC [Escherichia coli HVH 65 (4-2262045)]
GI:16128428 GenBank EQW06394.1 132 long-chain acyl-CoA thioesterase tesC [Escherichia coli KOEGE 77 (202a)]
GI:16128428 GenBank ESA73568.1 132 acyl-CoA thioester hydrolase, YbgC/YbaW family [Escherichia coli 110957]
GI:16128428 GenBank ESD41674.1 132 acyl-CoA thioester hydrolase, YbgC/YbaW family [Escherichia coli 907889]
GI:16128428 GenBank ESK42296.1 132 long-chain acyl-CoA thioesterase tesC [Escherichia coli UMEA 3323-1]
GI:16128428 GenBank ETY49854.1 132 long-chain acyl-CoA thioesterase tesC [Escherichia coli BWH 40]