Gene/Proteome Database (LMPD)
LMPD ID
LMP007632
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
UDP-glucose:(heptosyl)lipopolysaccharide alpha-1,3-glucosyltransferase; lipopolysaccharide core biosynthesis protein; lipopolysaccharide glucosyltransferase I
Gene Symbol
Synonyms
ECK3621; JW3606; rfaG
Summary
Mutants have reduced OM vesiculation (McBroom, 2006). [More information is available at EcoGene: EG11339]. The lipopolysaccharide of Escherichia coli K-12 consists of two major components: the hydrophobic lipid A moiety inserted into the outer membrane and the phosphorylated core oligosaccharide . [More information is available at EcoCyc: EG11339].
Orthologs
Proteins
| UDP-glucose:(heptosyl)lipopolysaccharide alpha-1,3-glucosyltransferase; lipopolysaccharide core biosynthesis protein; lipopolysaccharide glucosyltransferase I [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_418088 |
| Protein GI | 16131502 |
| UniProt ID | P25740 |
| Length | 374 |
| RefSeq Status | REVIEWED |
| MIVAFCLYKYFPFGGLQRDFMRIASTVAARGHHVRVYTQSWEGDCPKAFELIQVPVKSHTNHGRNAEYYAWVQNHLKEHPADRVVGFNKMPGLDVYFAADVCYAEKVAQEKGFLYRLTSRYRHYAAFERATFEQGKSTKLMMLTDKQIADFQKHYQTEPERFQILPPGIYPDRKYSEQIPNSREIYRQKNGIKEQQNLLLQVGSDFGRKGVDRSIEALASLPESLRHNTLLFVVGQDKPRKFEALAEKLGVRSNVHFFSGRNDVSELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTTAVCGYAHYIADANCGTVIAEPFSQEQLNEVLRKALTQSPLRMAWAENARHYADTQDLYSLPEKAADIITGGLDG | |
Gene Information
Entrez Gene ID
Gene Name
UDP-glucose:(heptosyl)lipopolysaccharide alpha-1,3-glucosyltransferase; lipopolysaccharide core biosynthesis protein; lipopolysaccharide glucosyltransferase I
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008919 | IDA:EcoCyc | F | lipopolysaccharide glucosyltransferase I activity |
| GO:0009244 | IMP:EcoCyc | P | lipopolysaccharide core region biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco00540 | Lipopolysaccharide biosynthesis |
| ko00540 | Lipopolysaccharide biosynthesis |
| eco01100 | Metabolic pathways |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| LIPA-CORESYN-PWY | Lipid A-core biosynthesis |
| LIPA-CORESYN-PWY | Lipid A-core biosynthesis |
| LPSSYN-PWY | superpathway of lipopolysaccharide biosynthesis |
| LPSSYN-PWY | superpathway of lipopolysaccharide biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001296 | Glycosyl transferase, family 1 |
UniProt Annotations
Entry Information
Gene Name
UDP-glucose:(heptosyl)lipopolysaccharide alpha-1,3-glucosyltransferase; lipopolysaccharide core biosynthesis protein; lipopolysaccharide glucosyltransferase I
Protein Entry
RFAG_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Function | Involved in the addition of the first glucose residue to the lipopolysaccharide core. |
| Pathway | Bacterial outer membrane biogenesis; LPS core biosynthesis. |
| Similarity | Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007632 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16131502 | RefSeq | NP_418088 | 374 | UDP-glucose:(heptosyl)lipopolysaccharide alpha-1,3-glucosyltransferase; lipopolysaccharide core biosynthesis protein; lipopolysaccharide glucosyltransferase I [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007632 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131502 | EMBL | CDY63068.1 | 374 | lipopolysaccharide glucosyltransferase I [Escherichia coli] |
| GI:16131502 | EMBL | CDZ22409.1 | 374 | lipopolysaccharide glucosyltransferase I [Escherichia coli] |
| GI:16131502 | GenBank | KGL70287.1 | 374 | glucosyltransferase I RfaG [Escherichia coli NCTC 50110] |
| GI:16131502 | GenBank | KGM67010.1 | 374 | Lipopolysaccharide core biosynthesis protein [Escherichia coli] |
| GI:16131502 | GenBank | KGM76131.1 | 374 | Lipopolysaccharide core biosynthesis protein [Escherichia coli] |
| GI:16131502 | gnl | IGS | 374 | glucosyltransferase I [Escherichia coli ER2796] |
Related Sequences to LMP007632 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131502 | GenBank | EGB61345.1 | 374 | glycosyl transferase group 1 [Escherichia coli M863] |
| GI:16131502 | GenBank | EGE62458.1 | 374 | lipopolysaccharide core biosynthesis protein rfaG [Escherichia coli STEC_7v] |
| GI:16131502 | GenBank | KEN39244.1 | 374 | lipopolysaccharide core biosynthesis protein rfaG [Escherichia coli 7-233-03_S4_C1] |
| GI:16131502 | GenBank | KEN51531.1 | 374 | lipopolysaccharide core biosynthesis protein rfaG [Escherichia coli 7-233-03_S4_C3] |
| GI:16131502 | RefSeq | WP_000634284.1 | 374 | glucosyltransferase [Escherichia coli] |
| GI:16131502 | RefSeq | WP_032292525.1 | 374 | glucosyltransferase I RfaG [Escherichia coli] |