Gene/Proteome Database (LMPD)
LMPD ID
LMP007644
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
acyl-CoA thioesterase 2
Gene Symbol
Synonyms
ECK0446; JW0442
Summary
None
Orthologs
Proteins
| acyl-CoA thioesterase 2 [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_414986 |
| Protein GI | 16128437 |
| UniProt ID | P0AGG2 |
| Length | 286 |
| RefSeq Status | REVIEWED |
| MSQALKNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALYAAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYMTASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPVEFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEPGIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGVMRNHN | |
Gene Information
Entrez Gene ID
Gene Name
acyl-CoA thioesterase 2
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0047617 | IDA:EcoCyc | F | acyl-CoA hydrolase activity |
| GO:0006637 | IEA:InterPro | P | acyl-CoA metabolic process |
| GO:0009062 | IMP:EcoCyc | P | fatty acid catabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco01040 | Biosynthesis of unsaturated fatty acids |
| ko01040 | Biosynthesis of unsaturated fatty acids |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-5148 | acyl-CoA hydrolysis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Can hydrolyze a broad range of acyl-CoA thioesters. Its physiological function is not known. |
| Similarity | Belongs to the C/M/P thioester hydrolase family. {ECO:0000305}. |
| Subunit | Homotetramer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007644 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16128437 | RefSeq | NP_414986 | 286 | acyl-CoA thioesterase 2 [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007644 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16128437 | GenBank | KHJ06424.1 | 286 | acyl-CoA thioesterase [Escherichia coli] |
| GI:16128437 | GenBank | KHJ15743.1 | 286 | acyl-CoA thioesterase [Escherichia coli] |
| GI:16128437 | GenBank | KHJ18294.1 | 286 | acyl-CoA thioesterase [Escherichia coli] |
| GI:16128437 | GenBank | KHJ27607.1 | 286 | acyl-CoA thioesterase [Escherichia coli] |
| GI:16128437 | GenBank | KHJ27951.1 | 286 | acyl-CoA thioesterase [Escherichia coli] |
| GI:16128437 | gnl | IGS | 286 | acyl-CoA thioesterase II [Escherichia coli ER2796] |
Related Sequences to LMP007644 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16128437 | GenBank | EGC96116.1 | 292 | acyl-CoA thioesterase II [Escherichia fergusonii ECD227] |
| GI:16128437 | GenBank | EGI09992.1 | 292 | acyl-CoA thioesterase II [Escherichia coli H736] |
| GI:16128437 | GenBank | EGI23184.1 | 292 | acyl-CoA thioesterase II [Escherichia coli M718] |
| GI:16128437 | GenBank | EGI47466.1 | 292 | acyl-CoA thioesterase II [Escherichia coli H591] |
| GI:16128437 | GenBank | EGJ07301.1 | 292 | acyl-CoA thioesterase II [Escherichia coli D9] |
| GI:16128437 | GenBank | EIE55708.1 | 292 | acyl-CoA thioesterase II [Escherichia coli AI27] |