Gene/Proteome Database (LMPD)
LMPD ID
LMP007646
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
outer membrane phospholipase A
Gene Symbol
Synonyms
ECK3815; JW3794
Summary
PldA is the Phospholipase A1 precursor which is a member of EC 3.1.1.32. [More information is available at EcoCyc: EG10738].
Orthologs
Proteins
| outer membrane phospholipase A [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_418265 |
| Protein GI | 16131671 |
| UniProt ID | P0A921 |
| Length | 289 |
| RefSeq Status | REVIEWED |
| MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQLSNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGYGGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF | |
Gene Information
Entrez Gene ID
Gene Name
outer membrane phospholipase A
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0045203 | IDA:EcoCyc | C | integral component of cell outer membrane |
| GO:0031230 | IDA:UniProtKB | C | intrinsic component of cell outer membrane |
| GO:0052740 | IEA:UniProtKB-EC | F | 1-acyl-2-lysophosphatidylserine acylhydrolase activity |
| GO:0005509 | IDA:UniProtKB | F | calcium ion binding |
| GO:0008970 | TAS:UniProtKB | F | phosphatidylcholine 1-acylhydrolase activity |
| GO:0052739 | IEA:UniProtKB-EC | F | phosphatidylserine 1-acylhydrolase activity |
| GO:0004623 | TAS:UniProtKB | F | phospholipase A2 activity |
| GO:0042803 | IDA:UniProtKB | F | protein homodimerization activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco00592 | alpha-Linolenic acid metabolism |
| ko00592 | alpha-Linolenic acid metabolism |
| eco00590 | Arachidonic acid metabolism |
| ko00590 | Arachidonic acid metabolism |
| eco00565 | Ether lipid metabolism |
| ko00565 | Ether lipid metabolism |
| eco00564 | Glycerophospholipid metabolism |
| ko00564 | Glycerophospholipid metabolism |
| eco01100 | Metabolic pathways |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| LIPASYN-PWY | phospholipases |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR003187 | PLipase_A1 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. |
| Catalytic Activity | Phosphatidylcholine + H(2)O = 2- acylglycerophosphocholine + a carboxylate. |
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000269|PubMed:10537112}; Note=Binds 1 Ca(2+) ion per monomer. In the dimeric form the Ca(2+) is bound by different amino acids with binding of each Ca(2+) shared with ligands coming from each monomer (Arg-167 and Ser-172 from 1 monomer, Ser-126 of the other). The Ca(2+) ion may have a role in catalysis. {ECO:0000269|PubMed:10537112}; |
| Enzyme Regulation | By membrane damage, for example, by phage- induced lysis or temperature shock. The protein is inactive in the monomeric form and active in the dimeric form; calcium is essential for dimer stability. {ECO:0000269|PubMed:10322034, ECO:0000269|PubMed:9013551}. |
| Function | Has broad substrate specificity including hydrolysis of phosphatidylcholine with phospholipase A2 (EC 3.1.1.4) and phospholipase A1 (EC 3.1.1.32) activities. Strong expression leads to outer membrane breakdown and cell death; is dormant in normal growing cells. Required for efficient secretion of bacteriocins. |
| Interaction | P37641:yhjC; NbExp=1; IntAct=EBI-1119179, EBI-849303; |
| Similarity | Belongs to the phospholipase A1 family. {ECO:0000305}. |
| Subcellular Location | Cell outer membrane {ECO:0000269|PubMed:6397463}; Multi-pass membrane protein {ECO:0000269|PubMed:6397463}. Note=One of the very few enzymes located there. |
| Subunit | Homodimer; dimerization is reversible, and the dimeric form is the active one. {ECO:0000269|PubMed:10322034, ECO:0000269|PubMed:10537112, ECO:0000269|PubMed:9013551}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007646 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16131671 | RefSeq | NP_418265 | 289 | outer membrane phospholipase A [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007646 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131671 | GenBank | KHJ06272.1 | 289 | phospholipase A [Escherichia coli] |
| GI:16131671 | GenBank | KHJ09459.1 | 289 | phospholipase A [Escherichia coli] |
| GI:16131671 | GenBank | KHJ17191.1 | 289 | phospholipase A [Escherichia coli] |
| GI:16131671 | GenBank | KHJ22091.1 | 289 | phospholipase A [Escherichia coli] |
| GI:16131671 | GenBank | KHJ23946.1 | 289 | phospholipase A [Escherichia coli] |
| GI:16131671 | gnl | IGS | 289 | outer membrane phospholipase A [Escherichia coli ER2796] |
Related Sequences to LMP007646 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131671 | GenBank | EOV19259.1 | 289 | phospholipase A1 [Escherichia coli KTE200] |
| GI:16131671 | GenBank | EOV56605.1 | 289 | phospholipase A1 [Escherichia coli KTE68] |
| GI:16131671 | GenBank | EOW44806.1 | 289 | phospholipase A1 [Escherichia coli KTE127] |
| GI:16131671 | GenBank | KFH98372.1 | 290 | phospholipase A [Escherichia coli] |
| GI:16131671 | gnl | tigr | 289 | phospholipase A1 [Escherichia coli SMS-3-5] |
| GI:16131671 | gnl | REF_tigr | 289 | phospholipase A [Escherichia coli SMS-3-5] |