Gene/Proteome Database (LMPD)
LMPD ID
LMP007658
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
lipopolysaccharide core biosynthesis
Gene Symbol
Synonyms
ECK3613; JW3598; rfaK; waaK
Summary
The lipopolysaccharide of Escherichia coli K-12 consists of two major components: the hydrophobic lipid A moiety inserted into the outer membrane and the phosphorylated core oligosaccharide . [More information is available at EcoCyc: EG11423].
Orthologs
Proteins
| lipopolysaccharide core biosynthesis [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_418080 |
| Protein GI | 16131494 |
| UniProt ID | P27242 |
| Length | 357 |
| RefSeq Status | REVIEWED |
| MRLGTFHKKKRFYINKIKINFLSFLFRNKINNQITDPAQVKSCLIIHDNNKLGDLIVLSSIYRELYSKGVKITLLTNRKGGEFLSNNKNIFEFCIKESTGFLEMLTLCKHLRDLQFDIVLDPFETMPSFKHSLILSSLKDSYILGFDHWYKRYYSFYHPHDECLKEHMSTRAIEILKHIYGEGKFSTNYDLHLPVDVEDKIKEFIGDTRIVIINPLGAKKICRLTFEQIKVIYQEVKTHFENYRIIFTGLPQDLLTIPILEIETLPFDEFIYTVALTKYSDFVISVDTALVHIAAAYHKPTLAFYPNSRTPEYPSHLIWSPNHHKSIQIVSPTYTVKDIDTETLTNSVKRLSCIDKK | |
Gene Information
Entrez Gene ID
Gene Name
lipopolysaccharide core biosynthesis
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0008917 | IEA:UniProtKB-EC | F | lipopolysaccharide N-acetylglucosaminyltransferase activity |
| GO:0016757 | IMP:EcoCyc | F | transferase activity, transferring glycosyl groups |
| GO:0009244 | IGI:EcoCyc | P | lipopolysaccharide core region biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco00540 | Lipopolysaccharide biosynthesis |
| ko00540 | Lipopolysaccharide biosynthesis |
| eco01100 | Metabolic pathways |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| LIPA-CORESYN-PWY | Lipid A-core biosynthesis |
| LIPA-CORESYN-PWY | Lipid A-core biosynthesis |
| LPSSYN-PWY | superpathway of lipopolysaccharide biosynthesis |
| LPSSYN-PWY | superpathway of lipopolysaccharide biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002201 | Glyco_trans_9 |
UniProt Annotations
Entry Information
Gene Name
lipopolysaccharide core biosynthesis
Protein Entry
WAAU_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-alpha-D-glucosamine + lipopolysaccharide = UDP + N-acetyl-alpha-D- glucosaminyllipopolysaccharide. |
| Function | Adds the terminal N-acetyl-D-glucosamine group on the glucose(II) group of LPS. |
| Pathway | Bacterial outer membrane biogenesis; LPS core biosynthesis. |
| Subcellular Location | Membrane; Peripheral membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007658 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16131494 | RefSeq | NP_418080 | 357 | lipopolysaccharide core biosynthesis [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007658 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131494 | EMBL | CDZ22401.1 | 357 | lipopolysaccharide core biosynthesis; heptosyl transferase IV; probably hexose transferase [Escherichia coli] |
| GI:16131494 | GenBank | KGL69997.1 | 357 | lipopolysaccharide core biosynthesis [Escherichia coli NCTC 50110] |
| GI:16131494 | GenBank | KGM67018.1 | 357 | lipopolysaccharide core biosynthesis [Escherichia coli] |
| GI:16131494 | GenBank | KGM76139.1 | 357 | Lipopolysaccharide 1,2-N-acetylglucosaminetransferase [Escherichia coli] |
| GI:16131494 | GenBank | KHH63976.1 | 357 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase [Escherichia coli] |
| GI:16131494 | gnl | IGS | 357 | lipopolysaccharide core biosynthesis [Escherichia coli ER2796] |
Related Sequences to LMP007658 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131494 | GenBank | AAA24523.1 | 357 | rfaK [Escherichia coli] |
| GI:16131494 | GenBank | EYV92610.1 | 357 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase [Escherichia coli O86:H34 str. 99-3124] |
| GI:16131494 | GenBank | KDV79061.1 | 357 | glycosyltransferase 9 family protein [Escherichia coli 2-052-05_S4_C3] |
| GI:16131494 | GenBank | KDY17421.1 | 357 | glycosyltransferase 9 family protein [Escherichia coli 2-316-03_S4_C2] |
| GI:16131494 | RefSeq | WP_032187723.1 | 357 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase [Escherichia coli] |
| GI:16131494 | RefSeq | WP_032208071.1 | 357 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase [Escherichia coli] |