Gene/Proteome Database (LMPD)

LMPD ID
LMP007659
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
putative glycosyl transferase
Gene Symbol
Synonyms
ECK2049; JW2040
Summary
The ortholog of WcaE in pathogenic Escherichia coli O157:H7 is involved in synthesis of colanic acid . [More information is available at EcoCyc: G7100].
Orthologs

Proteins

putative glycosyl transferase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416559
Protein GI 16129995
UniProt ID P71239
Length 248
RefSeq Status REVIEWED
MLLSIITVAFRNLEGIVKTHASLAHLAQVEDISFEWIVVDGGSNDGTREYLENLNGIFNLRFVSEPDNGIYDAMNKGIAMAQGKFALFLNSGDIFHQNAANFVRKLKMQKDNVMITGDALLDFGDGHKIKRSAKPGWYIYHSLPASHQAIFFPVSGLKKWRYDLEYKVSSDYALAAKMYKAGYAFKKLNGLVSEFSMGGVSTTNNMELCADAKKVQRQILHVPGFWAELSWHLRQRTTSKTKALYNKV

Gene Information

Entrez Gene ID
Gene Name
putative glycosyl transferase
Gene Symbol
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0009103 IEA:UniProtKB-KW P lipopolysaccharide biosynthetic process
GO:0045228 IEA:UniProtKB-UniPathway P slime layer polysaccharide biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR024010 Colanic_acid_synth_WcaE
IPR001173 Glycosyltransferase 2-like
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
putative glycosyl transferase
Protein Entry
WCAE_ECOLI
UniProt ID
Species
E. coli

Identical and Related Proteins

Unique RefSeq proteins for LMP007659 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129995 RefSeq NP_416559 248 putative glycosyl transferase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007659 proteins

Reference Database Accession Length Protein Name
GI:16129995 GenBank KHG77021.1 248 glycosyl transferase [Escherichia coli]
GI:16129995 GenBank KHH15718.1 248 glycosyl transferase [Escherichia coli]
GI:16129995 GenBank KHH53966.1 248 glycosyl transferase [Escherichia coli]
GI:16129995 GenBank KHH62187.1 248 glycosyl transferase [Escherichia coli]
GI:16129995 GenBank KHH71771.1 248 glycosyl transferase [Escherichia coli]
GI:16129995 gnl IGS 248 putative glycosyl transferase [Escherichia coli ER2796]

Related Sequences to LMP007659 proteins

Reference Database Accession Length Protein Name
GI:16129995 GenBank EMW19070.1 248 colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli 2850400]
GI:16129995 GenBank ENC16155.1 248 colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli P0299438.6]
GI:16129995 GenBank ENC18195.1 248 colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli P0299438.7]
GI:16129995 RefSeq WP_000927088.1 248 glycosyl transferase [Escherichia coli]
GI:16129995 RefSeq WP_001465460.1 248 colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli]
GI:16129995 RefSeq WP_001466241.1 248 colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli]