Gene/Proteome Database (LMPD)
LMPD ID
LMP007659
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
putative glycosyl transferase
Gene Symbol
Synonyms
ECK2049; JW2040
Summary
The ortholog of WcaE in pathogenic Escherichia coli O157:H7 is involved in synthesis of colanic acid . [More information is available at EcoCyc: G7100].
Orthologs
Proteins
putative glycosyl transferase [Escherichia coli str. K-12 substr. MG1655] | |
---|---|
Refseq ID | NP_416559 |
Protein GI | 16129995 |
UniProt ID | P71239 |
Length | 248 |
RefSeq Status | REVIEWED |
MLLSIITVAFRNLEGIVKTHASLAHLAQVEDISFEWIVVDGGSNDGTREYLENLNGIFNLRFVSEPDNGIYDAMNKGIAMAQGKFALFLNSGDIFHQNAANFVRKLKMQKDNVMITGDALLDFGDGHKIKRSAKPGWYIYHSLPASHQAIFFPVSGLKKWRYDLEYKVSSDYALAAKMYKAGYAFKKLNGLVSEFSMGGVSTTNNMELCADAKKVQRQILHVPGFWAELSWHLRQRTTSKTKALYNKV |
Gene Information
Entrez Gene ID
Gene Name
putative glycosyl transferase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
GO:0009103 | IEA:UniProtKB-KW | P | lipopolysaccharide biosynthetic process |
GO:0045228 | IEA:UniProtKB-UniPathway | P | slime layer polysaccharide biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP007659 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16129995 | RefSeq | NP_416559 | 248 | putative glycosyl transferase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007659 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16129995 | GenBank | KHG77021.1 | 248 | glycosyl transferase [Escherichia coli] |
GI:16129995 | GenBank | KHH15718.1 | 248 | glycosyl transferase [Escherichia coli] |
GI:16129995 | GenBank | KHH53966.1 | 248 | glycosyl transferase [Escherichia coli] |
GI:16129995 | GenBank | KHH62187.1 | 248 | glycosyl transferase [Escherichia coli] |
GI:16129995 | GenBank | KHH71771.1 | 248 | glycosyl transferase [Escherichia coli] |
GI:16129995 | gnl | IGS | 248 | putative glycosyl transferase [Escherichia coli ER2796] |
Related Sequences to LMP007659 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16129995 | GenBank | EMW19070.1 | 248 | colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli 2850400] |
GI:16129995 | GenBank | ENC16155.1 | 248 | colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli P0299438.6] |
GI:16129995 | GenBank | ENC18195.1 | 248 | colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli P0299438.7] |
GI:16129995 | RefSeq | WP_000927088.1 | 248 | glycosyl transferase [Escherichia coli] |
GI:16129995 | RefSeq | WP_001465460.1 | 248 | colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli] |
GI:16129995 | RefSeq | WP_001466241.1 | 248 | colanic acid biosynthesis glycosyltransferase WcaE [Escherichia coli] |