Gene/Proteome Database (LMPD)
LMPD ID
LMP007668
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
UDP-N-acetyl-D-mannosaminuronic acid transferase
Gene Symbol
Synonyms
ECK3787; JW3770; rff; rffM
Summary
None
Orthologs
Proteins
| UDP-N-acetyl-D-mannosaminuronic acid transferase [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_418242 |
| Protein GI | 16131650 |
| UniProt ID | P27836 |
| Length | 246 |
| RefSeq Status | REVIEWED |
| MNNNTTAPTYTLRGLQLIGWRDMQHALDYLFADGQLKQGTLVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQAQVSRVAGADLWEELMARAGKEGTPVFLVGGKPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQALFERIHASGAQIVTVAMGSPKQEIIMRDCRLVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLLSQPSRIKRQLRLLRYLRWHYTGNL | |
Gene Information
Entrez Gene ID
Gene Name
UDP-N-acetyl-D-mannosaminuronic acid transferase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0047241 | IEA:UniProtKB-HAMAP | F | lipopolysaccharide N-acetylmannosaminouronosyltransferase activity |
| GO:0016758 | IMP:EcoCyc | F | transferase activity, transferring hexosyl groups |
| GO:0009246 | IMP:EcoCyc | P | enterobacterial common antigen biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| ECASYN-PWY | enterobacterial common antigen biosynthesis |
| ECASYN-PWY | enterobacterial common antigen biosynthesis |
| ECASYN-PWY | enterobacterial common antigen biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
UDP-N-acetyl-D-mannosaminuronic acid transferase
Protein Entry
WECG_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-alpha-D-mannosaminouronate + N- acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol = UDP + N-acetyl-beta-D-mannosaminouronyl-(1->4)-N-acetyl-alpha-D- glucosaminyl-diphospho-ditrans,octacis-undecaprenol. {ECO:0000255|HAMAP-Rule:MF_01001, ECO:0000269|PubMed:3275612}. |
| Function | Catalyzes the synthesis of Und-PP-GlcNAc-ManNAcA (Lipid II), the second lipid-linked intermediate involved in enterobacterial common antigen (ECA) synthesis. {ECO:0000255|HAMAP-Rule:MF_01001, ECO:0000269|PubMed:1730666}. |
| Pathway | Bacterial outer membrane biogenesis; enterobacterial common antigen biosynthesis. {ECO:0000255|HAMAP-Rule:MF_01001}. |
| Similarity | Belongs to the glycosyltransferase 26 family. {ECO:0000255|HAMAP-Rule:MF_01001}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007668 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16131650 | RefSeq | NP_418242 | 246 | UDP-N-acetyl-D-mannosaminuronic acid transferase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007668 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131650 | GenBank | KHH93199.1 | 246 | UDP-N-acetyl-D-mannosaminuronic acid transferase [Escherichia coli] |
| GI:16131650 | GenBank | KHH97152.1 | 246 | UDP-N-acetyl-D-mannosaminuronic acid transferase [Escherichia coli] |
| GI:16131650 | GenBank | KHI15073.1 | 246 | UDP-N-acetyl-D-mannosaminuronic acid transferase [Escherichia coli] |
| GI:16131650 | GenBank | KHI17312.1 | 246 | UDP-N-acetyl-D-mannosaminuronic acid transferase [Escherichia coli] |
| GI:16131650 | GenBank | KHI53326.1 | 246 | UDP-N-acetyl-D-mannosaminuronic acid transferase [Escherichia coli] |
| GI:16131650 | gnl | IGS | 246 | UDP-N-acetyl-D-mannosaminuronic acid transferase [Escherichia coli ER2796] |
Related Sequences to LMP007668 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131650 | GenBank | EGW63532.1 | 246 | glycosyl transferase, WecB/TagA/CpsF family protein [Escherichia coli STEC_C165-02] |
| GI:16131650 | GenBank | EGW79535.1 | 246 | glycosyl transferase, WecB/TagA/CpsF family protein [Escherichia coli STEC_94C] |
| GI:16131650 | GenBank | EGW85557.1 | 246 | glycosyl transferase, WecB/TagA/CpsF family protein [Escherichia coli STEC_DG131-3] |
| GI:16131650 | GenBank | EGX01510.1 | 246 | glycosyl transferase, WecB/TagA/CpsF family protein [Escherichia coli STEC_MHI813] |
| GI:16131650 | GenBank | EMW32062.1 | 246 | glycosyltransferase, WecB/TagA/CpsF family protein [Escherichia coli 2785200] |
| GI:16131650 | RefSeq | WP_001724118.1 | 246 | glycosyltransferase, WecB/TagA/CpsF family protein [Escherichia coli] |